KEGG   Homo sapiens (human): 5522Help
Entry
5522              CDS       T01001                                 

Gene name
PPP2R2C, B55-GAMMA, B55gamma, IMYPNO, IMYPNO1, PR52, PR55G
Definition
(RefSeq) protein phosphatase 2 regulatory subunit Bgamma
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04728  Dopaminergic synapse
hsa05142  Chagas disease (American trypanosomiasis)
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
N00195  HPV E7 to host-cell-protein inhibition
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    5522 (PPP2R2C)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    5522 (PPP2R2C)
   04071 Sphingolipid signaling pathway
    5522 (PPP2R2C)
   04151 PI3K-Akt signaling pathway
    5522 (PPP2R2C)
   04152 AMPK signaling pathway
    5522 (PPP2R2C)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    5522 (PPP2R2C)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5522 (PPP2R2C)
  Nervous system
   04728 Dopaminergic synapse
    5522 (PPP2R2C)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    5522 (PPP2R2C)
   05165 Human papillomavirus infection
    5522 (PPP2R2C)
   05142 Chagas disease (American trypanosomiasis)
    5522 (PPP2R2C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5522 (PPP2R2C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5522 (PPP2R2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 5522
NCBI-ProteinID: NP_065149
OMIM: 605997
HGNC: 9306
Ensembl: ENSG00000074211
Vega: OTTHUMG00000090445
Pharos: Q9Y2T4(Tbio)
UniProt: Q9Y2T4
Position
4p16.1
AA seq 447 aa AA seqDB search
MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNA
PHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKI
TERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSIS
VNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVY
SSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRD
YLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNN
FFRMFDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAW
HPAENIIAIAATNNLYIFQDKVNSDMH
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaggacacggacacgcggaaaattaaccacagcttcctgcgggaccacagctat
gtgactgaagctgacatcatctctaccgttgagttcaaccacacgggagagctgctggcc
acaggtgacaagggcggccgggtcgtcatcttccagcgggaaccagagagtaaaaatgcg
ccccacagccagggcgaatacgacgtgtacagcactttccagagccacgagccggagttt
gactatctcaagagcctggagatagaggagaagatcaacaagatcaagtggctcccacag
cagaacgccgcccactcactcctgtccaccaacgataaaactatcaaattatggaagatt
accgaacgagataaaaggcccgaaggatacaacctgaaggatgaagaggggaaacttaag
gacctgtccacggtgacgtcactgcaggtgccagtgctgaagcccatggatctgatggtg
gaggtgagccctcggaggatctttgccaatggccacacctaccacatcaactccatctcc
gtcaacagtgactgcgagacctacatgtcggcggatgacctgcgcatcaacctctggcac
ctggccatcaccgacaggagcttcaacatcgtggacatcaagccggccaacatggaggac
cttacggaggtgatcacagcatctgagttccatccgcaccactgcaacctcttcgtctac
agcagcagcaagggctccctgcggctctgcgacatgcgggcagctgccctgtgtgacaag
cattccaagctctttgaagagcctgaggaccccagtaaccgctcattcttctcggaaatc
atctcctccgtgtccgacgtgaagttcagccacagcggccgctacatgctcacccgggac
taccttacagtcaaggtctgggacctgaacatggaggcaagacccatagagacctaccag
gtccatgactaccttcggagcaagctctgttccctgtacgagaacgactgcattttcgac
aagtttgaatgtgcctggaacgggagcgacagcgtcatcatgaccggggcctacaacaac
ttcttccgcatgttcgatcggaacaccaagcgggacgtgaccctggaggcctcgagggaa
agcagcaagccccgggctgtgctcaagccacggcgcgtgtgcgtggggggcaagcgccgg
cgtgatgacatcagtgtggacagcttggacttcaccaagaagatcctgcacacggcctgg
cacccggctgagaacatcattgccatcgccgccaccaacaacctgtacatcttccaggac
aaggtaaactctgacatgcactag

DBGET integrated database retrieval system