KEGG   Homo sapiens (human): 5523Help
Entry
5523              CDS       T01001                                 

Gene name
PPP2R3A, PPP2R3, PR130, PR72
Definition
(RefSeq) protein phosphatase 2 regulatory subunit B''alpha
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04728  Dopaminergic synapse
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5523 (PPP2R3A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    5523 (PPP2R3A)
   04151 PI3K-Akt signaling pathway
    5523 (PPP2R3A)
   04152 AMPK signaling pathway
    5523 (PPP2R3A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5523 (PPP2R3A)
  09156 Nervous system
   04728 Dopaminergic synapse
    5523 (PPP2R3A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5523 (PPP2R3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5523 (PPP2R3A)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5523 (PPP2R3A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5523 (PPP2R3A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5523 (PPP2R3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 DUF3924 NPIP DUF4116 DUF4187
Motif
Other DBs
NCBI-GeneID: 5523
NCBI-ProteinID: NP_002709
OMIM: 604944
HGNC: 9307
Ensembl: ENSG00000073711
Vega: OTTHUMG00000159766
Pharos: Q06190(Tbio)
UniProt: Q06190
Structure
PDB: 

Position
3q22.2-q22.3
AA seq 1150 aa AA seqDB search
MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGTCHTFTHGIDCIVVHHSVCADLLHIPV
SQFKDADLNSMFLPHENGLSSAEGDYPQQAFTGIPRVKRGSTFQNTYNLKDIAGEAISFA
SGKIKEFSFEKLKNSNHAAYRKGRKVKSDSFNRRSVDLDLLCGHYNNDGNAPSFGLLRSS
SVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCS
EDLKKCTDIIKQCIKKKSGSSISEGSGNDTISSSETVYMNVMTRLASYLKKLPFEFMQSG
NNEALDLTELISNMPSLQLTPFSPVFGTEQPPKYEDVVQLSASDSGRFQTIELQNDKPNS
RKMDTVQSIPNNSTNSLYNLEVNDPRTLKAVQVQSQSLTMNPLENVSSDDLMETLYIEEE
SDGKKALDKGQKTENGPSHELLKVNEHRAEFPEHATHLKKCPTPMQNEIGKIFEKSFVNL
PKEDCKSKVSKFEEGDQRDFTNSSSQEEIDKLLMDLESFSQKMETSLREPLAKGKNSNFL
NSHSQLTGQTLVDLEPKSKVSSPIEKVSPSCLTRIIETNGHKIEEEDRALLLRILESIED
FAQELVECKSSRGSLSQEKEMMQILQETLTTSSQANLSVCRSPVGDKAKDTTSAVLIQQT
PEVIKIQNKPEKKPGTPLPPPATSPSSPRPLSPVPHVNNVVNAPLSINIPRFYFPEGLPD
TCSNHEQTLSRIETAFMDIEEQKADIYEMGKIAKVCGCPLYWKAPMFRAAGGEKTGFVTA
QSFIAMWRKLLNNHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPE
FHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHF
YVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTRGKTIQKEGRMSYAD
FVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHD
LLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDG
PEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEK
CGKLQSVDEE
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaacttacagacttgtggttagtactgtgaaccactacagcagcgtggtgata
gaccggcgttttgaacaagctatacattattgcactggaacctgccacaccttcacacat
ggaattgactgcattgtggtacaccatagtgtttgtgcagacctcttgcacatccctgtg
tctcagttcaaagatgcagatctgaactctatgtttctaccccatgaaaatgggctttct
tcggctgaaggagactatccccaacaggccttcacaggcatacccagggtcaagagagga
tctacatttcagaatacctacaacttaaaggatattgcaggagaagcaatcagttttgcc
agtgggaaaataaaagaattttcctttgaaaaactcaaaaactctaaccatgcagcttac
agaaagggaaggaaagttaagtctgactcatttaataggaggtcagttgatttggacttg
ctttgtggccattataacaacgatgggaacgccccatcctttggtttactgcggagttcc
tcagttgaggaaaaacctttgtctcatagaaactcactggatacgaacctgacttccatg
tttcttcaaaacttttctgaagaagacttggttactcagattttggaaaaacataaaata
gataatttttcttctgggacagacataaagatgtgcttggacatcttattgaaatgctcc
gaggatttaaaaaaatgcacagacatcataaaacaatgcataaagaaaaaatcagggagt
agcatcagtgaaggaagtggtaatgatacaatttctagctctgaaactgtctatatgaat
gtaatgaccaggttagcatcctatctgaaaaagttaccatttgaattcatgcagtctggg
aataatgaggctctagatttaacagaactgatcagtaatatgcctagcttacaactgact
cccttctccccagtgtttggcactgaacaaccccctaaatatgaagatgttgtccagctc
tcagcttctgactctggacgatttcaaactattgaattgcaaaatgacaagcctaattct
aggaagatggacactgtacaatccattccaaacaactccacaaattccttatataactta
gaggtaaatgatcctagaactctaaaagctgtccaggtccaatcacagtcattaaccatg
aatcctttagaaaatgtttcttctgacgacttaatggaaactctttatattgaagaagag
tcagatggaaagaaagcattagataaaggacaaaagacagagaatggacctagtcatgag
ttattaaaggtaaatgaacatagagcagaatttccagaacatgctactcatcttaaaaaa
tgccccaccccaatgcaaaatgaaattggtaagatatttgagaaatcatttgttaatcta
cctaaggaagactgtaaatcaaaagtttctaaatttgaagagggagaccagagagatttt
acaaattccagtagccaggaagagatagataaattgttaatggatttggaatctttttca
cagaagatggagacctctctaagagagccacttgcgaagggtaaaaactctaatttttta
aatagtcacagtcagttgaccggtcagacccttgtagatcttgagcctaaatctaaagtc
tcttcacccatagaaaaagtctcaccttcctgtctaacaaggattattgaaaccaatgga
cacaaaatagaggaagaggatcgagccctcttactgcgaatcctggaaagcattgaagac
tttgctcaagaactagttgaatgcaaatcaagcagagggagcctatcacaagaaaaggaa
atgatgcaaattctacaggaaaccttgacaacttcctcccaggccaatttatcagtctgt
agaagtcctgttggtgataaagccaaagatactacttcagcagttttgattcagcagact
ccagaggtgatcaagattcaaaataaaccagaaaagaaacctggaacaccactcccacct
ccagccacctctccaagtagtccccgacctctctccccggttccccatgtgaataatgtt
gtgaatgcgccattgtccataaacattccacggttctactttcctgaaggactcccagat
acctgtagtaatcatgaacaaactctaagcagaattgaaactgctttcatggatattgaa
gaacagaaagcagacatttatgaaatggggaaaattgcaaaggtctgtggctgtcctctc
tattggaaagcccccatgttcagggctgcagggggagagaagacaggatttgtgacagca
cagtcattcattgccatgtggagaaagttgctgaataaccatcatgatgatgcctctaaa
ttcatctgtcttctagcaaagcccaactgcagctctctagaacaggaggatttcatccct
ctacttcaggatgtggtggatacccaccctggtctcacgttcctgaaagatgctccagaa
ttccactcccgctacatcaccacggttattcagagaatattctacacagtcaacagatct
tggagtggaaaaattacttcgacagagataagaaaaagcaactttttgcaaaccctagca
cttttggaagaagaggaagatataaaccaaattacagattacttctcctatgaacatttc
tatgttatttattgtaaattctgggaactagatactgatcacgacctctacatcagccag
gccgatctgtctcgatacaatgaccaggcttcatcaagcaggattattgaaaggatattc
tctggtgcagtaacaaggggaaaaacaatacagaaagagggaagaatgagctatgcagat
tttgtttggtttttgatctctgaagaagacaaaaggaatcctaccagcattgagtattgg
ttccgctgcatggatgtggatggagacggtgtactctccatgtatgagctggagtacttc
tatgaggagcagtgtgaacggatggaagccatgggaattgagcccttgccattccatgat
ttactgtgccagatgcttgacctagtgaagccagctgttgatggcaaaataactctaaga
gatctgaagaggtgcagaatggctcacatcttctatgacactttctttaatctggagaaa
tacttagaccatgaacagagagatccctttgcggtccagaaggatgttgagaacgatggg
cctgagccctcagactgggaccggtttgccgctgaggagtatgagacgcttgttgcagag
gaatctgcccaagcacaattccaggaaggctttgaagattatgaaacagatgaacctgcc
tctccctctgaatttggaaacaaaagcaataaaatattaagtgcaagccttccagagaaa
tgtggaaagcttcaatcagtggatgaagaatag

DBGET integrated database retrieval system