KEGG   Homo sapiens (human): 5524Help
Entry
5524              CDS       T01001                                 

Gene name
PTPA, PP2A, PPP2R4, PR53
Definition
(RefSeq) protein phosphatase 2 phosphatase activator
  KO
K17605  serine/threonine-protein phosphatase 2A activator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    5524 (PTPA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5524 (PTPA)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Other PP2-interacting proteins
     5524 (PTPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTPA
Motif
Other DBs
NCBI-GeneID: 5524
NCBI-ProteinID: NP_821068
OMIM: 600756
HGNC: 9308
Ensembl: ENSG00000119383
Vega: OTTHUMG00000020774
Pharos: Q15257(Tchem)
UniProt: Q15257
Structure
PDB: 

Position
9q34.11
AA seq 358 aa AA seqDB search
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVK
GKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLD
RWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGN
STRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAG
SQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKT
GPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggctgagggcgagcggcagccgccgccagattcttcagaggaggcccctccagccact
cagaacttcatcattccaaaaaaggagatccacacagttccagacatgggcaaatggaag
cgttctcaggcatacgctgactacatcggattcatccttaccctcaacgaaggtgtgaag
gggaagaagctgaccttcgagtacagagtctccgagatgtggaatgaggttcatgaggaa
aaggagcaggctgcaaagcagagtgtgtcctgcgatgaatgcataccattaccccgcgcc
gggcactgtgcaccttcggaggccattgagaaactagtcgctcttctcaacacgctggac
aggtggattgatgagactcctccagtggaccagccctctcggtttgggaataaggcatac
aggacctggtatgccaaacttgatgaggaagcagaaaacttggtggccacagtggtccct
acccatctggcagctgctgtgcctgaggtggctgtttacctaaaggagtcagtggggaac
tccacgcgcattgactacggcacagggcatgaggcagccttcgctgctttcctctgctgt
ctctgcaagattggggtgctccgggtggatgaccaaatagctattgtcttcaaggtgttc
aatcggtaccttgaggttatgcggaaactccagaaaacatacaggatggagccagccggc
agccagggagtgtggggtctggatgacttccagtttctgcccttcatctggggcagttcg
cagctgatagaccacccatacctggagcccagacactttgtggatgagaaggccgtgaat
gagaaccacaaggactacatgttcctggagtgtatcctgtttattaccgagatgaagact
ggcccatttgcagagcactccaaccagctgtggaacatcagcgccgtcccttcctggtcc
aaagtgaaccagggtctcatccgcatgtataaggccgagtgcctggagaagttccctgtg
atccagcacttcaagttcgggagcctgctgcccatccatcctgtcacgtcgggctag

DBGET integrated database retrieval system