KEGG   Homo sapiens (human): 55240
Entry
55240             CDS       T01001                                 

Gene name
STEAP3, AHMIO2, STMP3, TSAP6, dudlin-2, dudulin-2, pHyde
Definition
(RefSeq) STEAP3 metalloreductase
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    55240 (STEAP3)
   04115 p53 signaling pathway
    55240 (STEAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55240 (STEAP3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     55240 (STEAP3)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Others
   Others
    55240 (STEAP3)
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct NAD_binding_2 Shikimate_DH 2-Hacid_dh_C IlvN Leg1 Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 55240
NCBI-ProteinID: NP_001008410
OMIM: 609671
HGNC: 24592
Ensembl: ENSG00000115107
Vega: OTTHUMG00000131402
Pharos: Q658P3(Tbio)
UniProt: Q658P3 A1P3F0
Structure
PDB: 
2VQ3 2VNS

Position
2q14.2
AA seq 488 aa
MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRN
PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQ
EHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSE
MALAMGFMPVDMGSLASAWEVEAMPLRLLPAWKVPTLLALGLFVCFYAYNFVRDVLQPYV
QESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAALQLRRGTKYQRFPDWLDHWLQ
HRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWVEEEVWRMEIY
LSLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSSLGFVALVLSTLHTLTYGWTRAFE
ESRYKFYLPPTFTLTLLVPCVVILAKALFLLPCISRRLARIRRGWERESTIKFTLPTDHA
LAEKTSHV
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgccagaagagatggacaagccactgatcagcctccacctggtggacagcgatagtagc
cttgccaaggtccccgatgaggcccccaaagtgggcatcctgggtagcggggactttgcc
cgctccctggccacacgcctggtgggctctggcttcaaagtggtggtggggagccgcaac
cccaaacgcacagccaggctgtttccctcagcggcccaagtgactttccaagaggaggca
gtgagctccccggaggtcatctttgtggctgtgttccgggagcactactcttcactgtgc
agtctcagtgaccagctggcgggcaagatcctggtggatgtgagcaaccctacagagcaa
gagcaccttcagcatcgtgagtccaatgctgagtacctggcctccctcttccccacttgc
acagtggtcaaggccttcaatgtcatctctgcctggaccctgcaggctggcccaagggat
ggtaacaggcaggtgcccatctgcggtgaccagccagaagccaagcgtgctgtctcggag
atggcgctcgccatgggcttcatgcccgtggacatgggatccctggcgtcagcctgggag
gtggaggccatgcccctgcgcctcctcccggcctggaaggtgcccaccctgctggccctg
gggctcttcgtctgcttctatgcctacaacttcgtccgggacgttctgcagccctatgtg
caggaaagccagaacaagttcttcaagctgcccgtgtccgtggtcaacaccacactgccg
tgcgtggcctacgtgctgctgtcactcgtgtacttgcccggcgtgctggcggctgccctg
cagctgcggcgcggcaccaagtaccagcgcttccccgactggctggaccactggctacag
caccgcaagcagatcgggctgctcagcttcttctgcgccgccctgcacgccctctacagc
ttctgcttgccgctgcgccgcgcccaccgctacgacctggtcaacctggcagtcaagcag
gtcttggccaacaagagccacctctgggtggaggaggaggtctggcggatggagatctac
ctctccctgggagtgctggccctcggcacgttgtccctgctggccgtgacctcactgccg
tccattgcaaactcgctcaactggagggagttcagcttcgttcagtcctcactgggcttt
gtggccctcgtgctgagcacactgcacacgctcacctacggctggacccgcgccttcgag
gagagccgctacaagttctacctgcctcccaccttcacgctcacgctgctggtgccctgc
gtcgtcatcctggccaaagccctgtttctcctgccctgcatcagccgcagactcgccagg
atccggagaggctgggagagggagagcaccatcaagttcacgctgcccacagaccacgcc
ctggccgagaagacgagccacgtatga

DBGET integrated database retrieval system