KEGG   Homo sapiens (human): 55246
Entry
55246             CDS       T01001                                 

Gene name
CCDC25
Definition
(RefSeq) coiled-coil domain containing 25
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: NFACT-R_1 DDRGK PVL_ORF50
Other DBs
NCBI-GeneID: 55246
NCBI-ProteinID: NP_060716
HGNC: 25591
Ensembl: ENSG00000147419
Vega: OTTHUMG00000132173
Pharos: Q86WR0(Tdark)
UniProt: Q86WR0
Position
8p21.1
AA seq 208 aa
MVFYFTSSSVNSSAYTIYMGKDKYENEDLIKHGWPEDIWFHVDKLSSAHVYLRLHKGENI
EDIPKEVLMDCAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHRQKDVKIV
TVEKKVNEILNRLEKTKVERFPDLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREM
DELRSYSSLMKVENMSSNQDGNDSDEFM
NT seq 627 nt   +upstreamnt  +downstreamnt
atggtgttctacttcaccagcagcagcgttaattcatctgcctacactatttacatggga
aaagataaatatgaaaatgaagatctgatcaagcatggctggcctgaagatatctggttt
catgtggacaaactctcttcggctcatgtataccttcgattacataagggagagaatata
gaagacatcccaaaggaagtgctgatggactgtgcccaccttgtgaaggccaatagcatt
caaggctgcaagatgaacaacgttaatgtggtatatacgccgtggtctaacctgaagaaa
acagctgacatggatgtggggcagataggctttcacaggcagaaggatgtaaaaattgtg
acagtggagaagaaagtaaatgagatcctgaaccgattagaaaagaccaaagtcgagcgg
ttcccagacctagcagcagagaaagaatgcagagatcgtgaagagaggaatgagaaaaaa
gcccaaattcaggaaatgaaaaagagagaaaaagaagaaatgaagaagaagagggaaatg
gatgaacttaggagctattcatcactaatgaaagttgaaaatatgtcttcaaatcaggat
ggcaatgattcagatgaattcatgtaa

DBGET integrated database retrieval system