KEGG   Homo sapiens (human): 55248
Entry
55248             CDS       T01001                                 
Symbol
PACC1, ASOR, C1orf75, PAC, PAORAC, TMEM206, hPAC, hTMEM206
Name
(RefSeq) proton activated chloride channel 1
  KO
K25860  proton-activated chloride channel
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55248 (PACC1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   55248 (PACC1)
SSDB
Motif
Pfam: TMEM206 Tetraspanin
Other DBs
NCBI-GeneID: 55248
NCBI-ProteinID: NP_060722
OMIM: 618427
HGNC: 25593
Ensembl: ENSG00000065600
UniProt: Q9H813
Position
1:complement(212363928..212414886)
AA seq 350 aa
MIRQERSTSYQELSEELVQVVENSELADEQDKETVRVQGPGILPGLDSESASSSIRFSKA
CLKNVFSVLLIFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYP
GQAQLLSCKHHYEVIPPLTSPGQPGDMNCTTQRINYTDPFSNQTVKSALIVQGPREVKKR
ELVFLQFRLNKSSEDFSAIDYLLFSSFQEFLQSPNRVGFMQACESAYSSWKFSGGFRTWV
KMSLVKTKEEDGREAVEFRQETSVVNYIDQRPAAKKSAQLFFVVFEWKDPFIQKVQDIVT
ANPWNTIALLCGAFLALFKAAEFAKLSIKWMIKIRKRYLKRRGQATSHIS
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgatccggcaggagcgctccacatcctaccaggagctgagtgaggagttggtccaggtg
gttgagaactcagagctggcagacgagcaggacaaggagacggtcagagtccaaggtccg
ggtatcttaccaggcctggacagcgagtccgcctccagcagcatccgcttcagcaaggcc
tgcctgaagaacgtcttctcggtcctactcatcttcatctacctgctgctcatggctgtg
gccgtcttcctggtctaccggaccatcacagactttcgtgagaaactcaagcaccctgtc
atgtctgtgtcttacaaggaagtggatcgctatgatgccccaggtattgccttgtacccc
ggtcaggcccagttgctcagctgtaagcaccattacgaggtcattcctcctctgacaagc
cctggccagccgggtgacatgaattgcaccacccagaggatcaactacacggaccccttc
tccaatcagactgtgaaatctgccctgattgtccaggggccccgggaagtgaaaaagcgg
gagctggtcttcctccagttccgcctgaacaagagtagtgaggacttcagcgccattgat
tacctcctcttctcttctttccaggagttcctgcaaagcccaaacagggtaggcttcatg
caggcctgtgagagtgcctattccagctggaagttctctgggggcttccgcacctgggtc
aagatgtcactggtaaagaccaaggaggaggatgggcgggaagcagtggagttccggcag
gagacaagtgtggttaactacattgaccagaggccagctgccaaaaaaagtgctcaattg
ttttttgtggtctttgaatggaaagatcctttcatccagaaagtccaagatatagtcact
gccaatccttggaacacaattgctcttctctgtggcgccttcttggcattatttaaagca
gcagagtttgccaaactgagtataaaatggatgatcaaaattagaaagagataccttaaa
agaagaggtcaggcaacgagccacataagctga

DBGET integrated database retrieval system