KEGG   Homo sapiens (human): 55253
Entry
55253             CDS       T01001                                 
Symbol
TYW1, RSAFD1, TYW1A, YPL207W
Name
(RefSeq) tRNA-yW synthesizing protein 1 homolog
  KO
K15449  tRNA wybutosine-synthesizing protein 1 [EC:4.1.3.44]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    55253 (TYW1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.44  tRNA 4-demethylwyosine synthase (AdoMet-dependent)
     55253 (TYW1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    55253 (TYW1)
SSDB
Motif
Pfam: Flavodoxin_1 Wyosine_form Radical_SAM
Other DBs
NCBI-GeneID: 55253
NCBI-ProteinID: NP_060734
OMIM: 611243
HGNC: 25598
Ensembl: ENSG00000198874
UniProt: Q9NV66
Position
7:66996833..67239514
AA seq 732 aa
MDPSADTWDLFSPLISLWINRFYIYLGFAVSISLWICVQIVIKTQGKNLQEKSVPKAAQD
LMTNGYVSLQEKDIFVSGVKIFYGSQTGTAKGFATVLAEAVTSLDLPVAIINLKEYDPDD
HLIEEVTSKNVCVFLVATYTDGLPTESAEWFCKWLEEASIDFRFGKTYLKGMRYAVFGLG
NSAYASHFNKVGKNVDKWLWMLGAHRVMSRGEGDCDVVKSKHGSIEADFRAWKTKFISQL
QALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSHEQDELHHRDTEEEEPFESSSEEEF
GGEDHQSLNSIVDVEDLGKIMDHVKKEKREKEQQEEKSGLFRNMGRNEDGERRAMITPAL
REALTKQGYQLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKC
VFCWRHHTNPVGTEWRWKMDQPEMILKEAIENHQNMIKQFKGVPGVKAERFEEGMTVKHC
ALSLVGEPIMYPEINRFLKLLHQCKISSFLVTNAQFPAEIRNLEPVTQLYVSVDASTKDS
LKKIDRPLFKDFWQRFLDSLKALAVKQQRTVYRLTLVKAWNVDELQAYAQLVSLGNPDFI
EVKGVTYCGESSASSLTMAHVPWHEEVVQFVHELVDLIPEYEIACEHEHSNCLLIAHRKF
KIGGEWWTWIDYNRFQELIQEYEDSGGSKTFSAKDYMARTPHWALFGASERGFDPKDTRH
QRKNKSKAISGC
NT seq 2199 nt   +upstreamnt  +downstreamnt
atggatccttctgcggatacatgggacctcttctcacctttaatatcattatggataaac
aggttttacatttatttgggctttgctgttagcattagcctttggatttgtgtccagatt
gtcatcaagacgcagggcaagaacttacaggaaaaatctgttccaaaagcagctcaggat
ttgatgacaaatggttatgtctcccttcaagagaaagacatctttgtgtctggagtgaag
attttttatggttctcagactggaacagcgaagggattcgcaacagttcttgctgaagca
gttacatccctggatctgcctgtggccattattaatctaaaagaatatgatccagatgat
catctgatagaagaggtgactagtaaaaatgtctgtgtcttcctggttgcgacatacact
gacggcctaccaactgaaagtgcagagtggttctgcaaatggttagaggaagcatccatt
gattttcgatttggcaaaacttacctgaagggtatgagatatgcggtatttggcctggga
aattctgcctatgctagccacttcaacaaggttggcaaaaatgttgacaagtggctctgg
atgcttggcgcgcatcgtgtgatgagtcgaggggagggcgactgcgacgtggttaaaagc
aagcacggcagcattgaggccgacttcagagcatggaagaccaagttcatctcccagctg
caggcacttcagaaaggggagagaaagaagtcctgtggcggccactgcaagaaaggcaaa
tgtgaatctcaccaacatggctcagaggagagggaggaaggatctcatgagcaggatgaa
ttgcatcatagagacaccgaggaggaagaaccctttgagagctccagtgaagaagagttt
ggtggtgaggaccatcagagcctaaattccattgttgatgttgaagatttgggcaaaatt
atggatcatgtgaagaaagaaaagagagaaaaggaacagcaggaagagaagtctggtttg
ttcaggaacatggggaggaatgaagatggtgaaagaagagctatgataactcctgctctc
cgagaagcccttactaaacaaggttatcagttgattgggagccactcgggggtgaagctt
tgcaggtggacaaagtccatgctccgagggagaggaggttgttacaaacacacattctat
ggaattgagagccatcgctgcatggaaaccaccccgagcttggcgtgtgctaataaatgt
gtcttctgttggcggcaccacaccaaccccgtgggcactgagtggcggtggaagatggac
cagcctgaaatgatcttgaaggaagccattgaaaaccatcagaacatgattaagcagttt
aaaggagtaccgggcgtcaaagcagaacgctttgaagaaggaatgacggtaaagcactgt
gcattgtccctcgtgggagaaccaataatgtacccagagatcaacaggtttttgaagcta
ctccaccagtgtaaaatttccagcttcctggtcacaaacgcacaatttcctgcggaaatc
aggaacctcgagccggttactcagctgtatgtcagtgtggatgccagtaccaaagacagc
ctgaagaaaatcgaccgcccactcttcaaggatttctggcagagattccttgacagttta
aaagccttggcagtcaagcaacaacgaactgtctacagactgacgctcgtgaaagcatgg
aacgtggacgagctccaggcctacgcgcagctcgtgtccctggggaatcctgacttcatc
gaagtgaagggcgttacctactgcggagaaagttcagcaagcagtcttaccatggcccac
gtgccctggcatgaggaagtggtacagtttgtccacgagttggtggatctgatccccgaa
tatgaaattgcatgtgaacacgaacactctaattgcctcctgatagcacacagaaagttt
aaaattggtggtgaatggtggacatggatcgattataaccgcttccaggagctcatccag
gaatatgaagatagtggtggatcaaaaacgttcagcgcaaaggattatatggccagaact
cctcactgggcattatttggtgccagtgaaagaggctttgatcccaaggacacaagacat
cagagaaagaacaaatcaaaggctatttctggatgttga

DBGET integrated database retrieval system