KEGG   Homo sapiens (human): 55256
Entry
55256             CDS       T01001                                 

Gene name
ADI1, APL1, ARD, Fe-ARD, HMFT1638, MTCBP1, Ni-ARD, SIPL, mtnD
Definition
(RefSeq) acireductone dioxygenase 1
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa01100  Metabolic pathways
Module
hsa_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    55256 (ADI1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     55256 (ADI1)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     55256 (ADI1)
SSDB
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_3 Cupin_8 Cupin_1
Other DBs
NCBI-GeneID: 55256
NCBI-ProteinID: NP_060739
OMIM: 613400
HGNC: 30576
Ensembl: ENSG00000182551
Vega: OTTHUMG00000112441
Pharos: Q9BV57(Tbio)
UniProt: Q9BV57
Structure
PDB: 
4QGN

Position
2p25.3
AA seq 179 aa
MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERN
YSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFME
KGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
NT seq 540 nt   +upstreamnt  +downstreamnt
atggtgcaggcctggtatatggacgacgccccgggcgacccgcggcaaccccaccgcccc
gaccccggccgcccagtgggcctggagcagctgcggcggctcggggtgctctactggaag
ctggatgctgacaaatatgagaatgatccagaattagaaaagatccgaagagagaggaac
tactcctggatggacatcataaccatatgcaaagataaactaccaaattatgaagaaaag
attaagatgttctacgaggagcatttgcacttggacgatgagatccgctacatcctggat
ggcagtgggtacttcgatgtgagggacaaggaggaccagtggatccggatcttcatggag
aagggagacatggtgacgctccccgcggggatctatcaccgcttcacggtggacgagaag
aactacacgaaggccatgcggctgtttgtgggagaaccggtgtggacagcgtacaaccgg
cccgctgaccattttgaagcccgcgggcagtacgtgaaatttctggcacagaccgcctag

DBGET integrated database retrieval system