KEGG   Homo sapiens (human): 55257Help
Entry
55257             CDS       T01001                                 

Gene name
MRGBP, C20orf20, Eaf7, MRG15BP, URCC4
Definition
(RefSeq) MRG domain binding protein
  KO
K11343  MRG-binding protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    55257 (MRGBP)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     55257 (MRGBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Eaf7
Motif
Other DBs
NCBI-GeneID: 55257
NCBI-ProteinID: NP_060740
OMIM: 611157
HGNC: 15866
Ensembl: ENSG00000101189
Vega: OTTHUMG00000032940
Pharos: Q9NV56(Tbio)
UniProt: Q9NV56
Structure
PDB: 

Position
20q13.33
AA seq 204 aa AA seqDB search
MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICI
RDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKV
MIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRS
RVTDKVLTANSNPSSPSAAKRRRT
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgggagaggccgaggtgggcggcgggggcgccgcaggcgacaagggcccgggggaggcg
gccaccagcccggcggaggagacagtggtgtggagccccgaggtggaggtgtgcctcttc
cacgccatgctgggccacaagcccgtcggtgtgaaccgacacttccacatgatttgtatt
cgggacaagttcagccagaacatcgggcggcaggtcccatccaaggtcatctgggaccat
ctgagcaccatgtacgacatgcaggcgctgcatgagtctgagattcttccattcccgaat
ccagagaggaacttcgtccttccagaagagatcattcaggaggtccgagaaggaaaagtg
atgatagaagaggagatgaaagaggagatgaaggaagacgtggacccccacaatggggct
gacgatgttttttcatcttcagggagtttggggaaagcatcagaaaaatccagcaaagac
aaagagaagaactcctcagacttggggtgcaaagaaggcgcagacaagcggaagcgcagc
cgggtcaccgacaaagtcctgaccgcaaacagcaacccttccagtcccagtgctgccaag
cggcgccgcacgtag

DBGET integrated database retrieval system