KEGG   Homo sapiens (human): 55259
Entry
55259             CDS       T01001                                 
Symbol
DNAI7, CASC1, CFAP94, LAS1, PPP1R54
Name
(RefSeq) dynein axonemal intermediate chain 7
  KO
K17580  cancer susceptibility candidate protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    55259 (DNAI7)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    55259 (DNAI7)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     55259 (DNAI7)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Dynein arm
   55259 (DNAI7)
SSDB
Motif
Pfam: Casc1_N Casc1_C
Other DBs
NCBI-GeneID: 55259
NCBI-ProteinID: NP_001076442
OMIM: 616906
HGNC: 29599
Ensembl: ENSG00000118307
Pharos: Q6TDU7(Tdark)
UniProt: Q6TDU7 B4E376
Position
12:complement(25107047..25195160)
AA seq 716 aa
MSGSKKKKVTKAERLKLLQEEEERRLKEEEEARLKYEKEEMERLEIQRIEKEKWHRLEAK
DLERRNEELEELYLLERCFPEAEKLKQETKLLSQWKHYIQCDGSPDPSVAQEMNTFISLW
KEKTNETFEEVIEKSKVVLNLIEKLKFILLETPPCDLQDKNIIQYQESILQLQELLHLKF
GVATEILLKQASTLADLDSGNMEKVIKDENVTLYVWANLKKNPRHRSVRFSETQIGFEIP
RILATSDIAVRLLHTHYDHVSALHPVSTPSKEYTSAVTELVKDDVKNVEKAISKEVEEES
KQQERGSHLIQEEEIKVEEEQGDIEVKMSSAEEESEAIKCEREMKVLSETVSAAQLLLVE
NSSEKPDFFEDNVVDLCQFTTLGGVYHLDILELPPQCKPVKGWMIVEILKEGLQKYTYPP
ETTEEFETENAFPPIEVTLEVHENVIFFEDPVVVRWDAEGKHWRTDGISNVSYKPKERLV
TFSLDTFGPVTLIQDAHINMPYQSWELRPLDVNKVLLTVTTVFTEIQIQIKENLCMLSSI
KLKDKKHISILEGTWMTPIPFIIALKEAGLNIFPTRHSHFYVIINNKVPLVEVKAYRQMA
LLSSAFAFGWSKWNLLCNSTKVVFKVREHLTEACTENPNWALLMFSGDRAQRLKIKEESE
AFSEALKEETEFHSTLYHMVKDFASEEAMEKVRSSNCQFVNSVCHMLLSTRLLSYS
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgtctggcagtaagaaaaagaaagtcaccaaagctgaacgattgaagctgctacaagag
gaggaggagagacgactgaaagaggaagaggaagcccgtttgaaatatgagaaagaagaa
atggaaaggcttgaaatacagcgaattgagaaagaaaaatggcatcgacttgaagcaaaa
gatctagaaaggagaaatgaagaacttgaagaactttatttattagagaggtgttttcct
gaagcagagaaattgaaacaggaaactaaattgctttctcagtggaagcactacattcaa
tgtgatgggagtcctgatccttcagtagcccaagaaatgaacacgtttattagtttgtgg
aaagagaaaacaaatgagacttttgaggaagtgattgagaagagtaaagtagtgctaaat
ttaattgagaaattgaaatttattttactggaaactccaccatgtgatttgcaagataaa
aatataatacagtaccaagaatcaatactacaactgcaggagctccttcatcttaaattc
ggtgtagccacagaaatacttctcaaacaagctagtactttggcagatctggacagtgga
aatatggaaaaagtcattaaagatgaaaatgttactctgtatgtgtgggcaaacctcaag
aagaatccaaggcacagaagtgttagattctctgaaacacaaattggatttgagattcca
aggatattagcaacaagtgacattgctgtacgactcctgcatacccactatgatcatgtt
tctgcactgcaccctgtttcaacaccatcaaaagaatacacttctgcagtaactgagctt
gtcaaagatgatgttaagaatgtagaaaaagcaatcagcaaggaggtcgaagaagagtcc
aaacaacaagaaagagggtctcacttaattcaggaggaagaaataaaagttgaggaggaa
caaggtgatattgaagtgaaaatgagttctgctgaggaagaatctgaagccataaaatgt
gaacgagagatgaaagtattaagtgaaactgtttcagcagcacagttgttgctggtagag
aattcttctgaaaagccagatttctttgaagacaatgtggtggatttatgccagttcaca
actctgggtggagtataccacttggatattttggagcttcctccacagtgtaaaccagtg
aagggatggatgattgtggaaatactcaaagaaggattacagaaatacacatatcctccg
gaaactacagaagagtttgagacagaaaatgctttcccacctatagaggtcacacttgag
gttcatgagaatgtaatcttttttgaggatcctgtggttgtaaggtgggatgctgaaggt
aaacattggagaactgatggcatcagcaatgtatcctacaaaccaaaagaaagacttgta
acattcagcctggacacctttggccctgttaccttgattcaagatgctcatattaacatg
ccgtaccagtcatgggaactaagaccacttgatgtaaataaagtacttttaactgtgact
acagtatttactgagattcaaatacaaattaaggaaaacctctgcatgttatcttcaatc
aaactaaaagacaagaaacacatctctattttggaaggaacctggatgactcctattcct
ttcattattgctttgaaagaagctggactgaatatctttcctactagacactctcatttt
tatgttattataaacaataaggttcctttggtagaagtgaaagcttatcgacagatggcc
ctactaagttctgcttttgcatttggttggagcaagtggaacctactatgtaattctaca
aaagtcgtatttaaggtgagggaacaccttactgaagcatgtactgagaatcctaattgg
gcccttttaatgtttagtggtgacagagcacaaagactgaagatcaaggaagagagtgag
gcattttctgaagcacttaaagaagaaactgagtttcattctactttatatcacatggtg
aaggattttgcttctgaggaagcaatggagaaagtcaggagttccaactgtcagtttgtc
aactctgtgtgccacatgctgctctctaccagattgctcagctactcctaa

DBGET integrated database retrieval system