KEGG   Homo sapiens (human): 55262
Entry
55262             CDS       T01001                                 
Symbol
TRAPPC14, C7orf43, MAP11, MCPH25
Name
(RefSeq) trafficking protein particle complex subunit 14
  KO
K24261  microtubule-associated protein 11
Organism
hsa  Homo sapiens (human)
Disease
H00269  Primary microcephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    55262 (TRAPPC14)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     55262 (TRAPPC14)
SSDB
Motif
Pfam: DUF4707 NEL
Other DBs
NCBI-GeneID: 55262
NCBI-ProteinID: NP_060745
OMIM: 618350
HGNC: 25604
Ensembl: ENSG00000146826
Pharos: Q8WVR3(Tdark)
UniProt: Q8WVR3
Position
7:complement(100154423..100158723)
AA seq 580 aa
MESQCDYSMYFPAVPLPPRAELAGDPGRYRALPRRNHLYLGETVRFLLVLRCRGGAGSGT
GGGPGLGSRGAWAELATALAALASVSAGGGMPGGGGAGDQDSEPPGGGDPGGGGLFRGCS
PLLTHGPGPATSGGATTLPVEEPIVSTDEVIFPLTVSLDRLPPGTPKAKIVVTVWKREIE
APEVRDQGYLRLLQTRSPGETFRGEQSAFKAQVSTLLTLLPPPVLRCRQFTVAGKHLTVL
KVLNSSSQEEISIWDIRILPNFNASYLPVMPDGSVLLVDNVCHQSGEVSMGSFCRLPGTS
GCFPCPLNALEEHNFLFQLRGGEQPPPGAKEGLEVPLIAVVQWSTPKLPFTQSIYTHYRL
PSVRLDRPCFVMTASCKSPVRTYERFTVTYTLLNNLQDFLAVRLVWTPEHAQAGKQLCEE
ERRAMQAALDSVVCHTPLNNLGFSRKGSALTFSVAFQALRTGLFELSQHMKLKLQFTASV
SHPPPEARPLSRKSSPSSPAVRDLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAI
TPPVASPVGRPLYLPPDKAVLSLDKIAKRECKVLVVEPVK
NT seq 1743 nt   +upstreamnt  +downstreamnt
atggagtcccagtgcgactactcgatgtacttcccggccgtgccgctgccgccgcgcgcg
gagctggcaggggatccgggccggtaccgggcgctgccccggcgcaaccatctgtacttg
ggggagactgtccgttttctgctggtgttgcgctgccggggcggtgcggggtccggcacc
gggggcggcccgggcttgggctccagaggagcctgggcagaactggcaaccgccctggcc
gccctggcctcggtcagcgccggaggcgggatgccggggggcggcggcgccggcgaccag
gattcggagcccccagggggaggggatcctgggggtgggggtttgttccgaggctgcagc
ccccttctcacccacggcccgggccctgctacctcagggggagcgaccacgctgcctgtg
gaggaaccgattgtgtccacagatgaggtcatcttcccactcaccgtttcactggataga
ctgcccccagggacacctaaggccaagattgtagtgactgtgtggaagcgggagattgag
gcaccagaggtcagagatcaaggctacctgcgattgctgcagacccgatctcctggggag
acattccggggcgagcagagcgctttcaaggcccaagtgagcacgctgctgactctgctg
ccccctccggttctgagatgccggcagttcactgtggctggaaaacacttgaccgtgctc
aaggtgctgaacagctcctctcaggaggaaatctccatctgggatatccgaatcctcccc
aacttcaacgccagttatctacctgtcatgcccgatggctctgtgctgctggtggacaat
gtctgtcaccagtctggggaagtctccatgggctccttctgccgcctacccgggacctct
ggctgcttcccctgcccgctgaatgccctggaggaacacaacttcctgtttcagctgaga
gggggtgagcagccccctccaggggccaaggagggcctggaagttcccctgattgctgtg
gttcagtggtctaccccaaagctgcccttcactcagagcatctacacccactaccgcctg
cccagtgtccgcttggaccgcccgtgttttgtgatgaccgcttcttgtaagtcccctgtt
cggacctacgagcgtttcactgtcacctacacgctgcttaacaatctccaagacttcctt
gctgtgaggctcgtgtggaccccagagcatgcacaggctggaaagcagctgtgtgaggag
gagcgccgggccatgcaggctgccctggactccgtcgtctgccacacgcccctcaacaac
cttggcttttcccggaagggcagcgcgctcaccttcagtgtggccttccaggctctgagg
acggggctcttcgagctaagccagcacatgaaactgaagctgcagttcaccgccagcgtg
tcccaccctccacccgaggcccggcccctctcccgcaagagcagccccagcagccctgct
gtccgggacttggtggagaggcatcaggctagcctgggccgctcccagtccttctcccac
cagcagccttcccgaagccacctcatgaggtcgggcagtgtgatggagcgcagagccatc
acgccccctgtggcctctcctgttggccgccccctctacctgcccccggacaaggctgtg
ttgtctctggacaagattgccaagcgcgagtgcaaggtcctggtggtggaacccgtcaag
tag

DBGET integrated database retrieval system