KEGG   Homo sapiens (human): 55269Help
Entry
55269             CDS       T01001                                 

Gene name
PSPC1, PSP1
Definition
(RefSeq) paraspeckle component 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 NOPS RRM_7
Motif
Other DBs
NCBI-GeneID: 55269
NCBI-ProteinID: NP_001035879
OMIM: 612408
HGNC: 20320
Ensembl: ENSG00000121390
Vega: OTTHUMG00000016502
Pharos: Q8WXF1(Tbio)
UniProt: Q8WXF1
Structure
PDB: 

Position
13q12.11
AA seq 523 aa AA seqDB search
MMLRGNLKQVRIEKNPARLRALESAVGESEPAAAAAMALALAGEPAPPAPAPPEDHPDEE
MGFTIDIKSFLKPGEKTYTQRCRLFVGNLPTDITEEDFKRLFERYGEPSEVFINRDRGFG
FIRLESRTLAEIAKAELDGTILKSRPLRIRFATHGAALTVKNLSPVVSNELLEQAFSQFG
PVEKAVVVVDDRGRATGKGFVEFAAKPPARKALERCGDGAFLLTTTPRPVIVEPMEQFDD
EDGLPEKLMQKTQQYHKEREQPPRFAQPGTFEFEYASRWKALDEMEKQQREQVDRNIREA
KEKLEAEMEAARHEHQLMLMRQDLMRRQEELRRLEELRNQELQKRKQIQLRHEEEHRRRE
EEMIRHREQEELRRQQEGFKPNYMENREQEMRMGDMGPRGAINMGDAFSPAPAGNQGPPP
MMGMNMNNRATIPGPPMGPGPAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPSQMGSPMG
SRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgatgttaagaggaaacctgaagcaagtgcgcattgagaaaaacccggcccgccttcgc
gccctggagtccgcggtgggcgagagcgagccggcggccgcggcagccatggcgctcgct
cttgccggggagccggcaccgcccgcgcccgcgcctccagaggaccacccggacgaggag
atggggttcactatcgacatcaagagtttcctcaagccgggcgagaagacgtacacgcag
cgctgccgcctcttcgtgggaaatctgcccaccgacatcacggaggaggacttcaagagg
ctcttcgaacgctatggcgagcccagcgaagtcttcatcaaccgggaccgtggcttcggc
ttcatccgcttggaatccagaaccctggctgaaattgcaaaagcagagctggacggcacc
attctcaagagcagacctctacggattcgcttcgctacacatggagcagccttgactgtc
aagaacctttctccagttgtttccaatgagctgctagagcaagcattttctcagtttggt
ccagtagagaaagctgttgtggttgtggatgatcgcggtagagctacaggaaaaggtttt
gtagagtttgcagcaaaacctcctgcacgaaaggctctggaaagatgtggtgatggggca
ttcttgctaacaacgacccctcgtccagtcattgtggaacccatggagcagtttgatgat
gaagatggcttgccagagaagctgatgcagaaaactcaacaatatcataaggaaagagaa
caaccaccacgttttgctcaacctgggacatttgaatttgagtatgcatctcgatggaag
gctcttgatgaaatggaaaagcagcagcgtgagcaggttgatagaaacatcagagaagcc
aaagagaaactggaggcagaaatggaagcagctaggcatgaacaccaattaatgctaatg
aggcaagatctaatgaggcgtcaagaagaactcagacgcttggaagaactcagaaaccaa
gagttgcaaaaacggaagcaaatacaactaagacatgaagaggagcatcggcggcgtgag
gaagaaatgatccgacacagagaacaggaggaactgaggcgacagcaagagggctttaag
ccaaactacatggaaaatagagaacaggaaatgagaatgggtgatatgggtccccgtgga
gcaataaacatgggagatgcgtttagcccagcccctgctggtaaccaaggtcctcctcca
atgatgggtatgaatatgaacaacagagcaactatacctggcccaccaatgggtcctggt
cctgccatgggaccagaaggagccgcaaatatgggaactccaatgatgccagataatgga
gcagtgcacaatgacagatttcctcaaggaccaccatctcagatgggttcacctatgggg
agtagaacaggttctgaaacccctcaagcaccaatgagtggtgtaggtcctgtgagtggt
ggtcctggtggctttggtagaggaagtcaagggggcaactttgaaggccctaataagcgt
cgtagatattaa

DBGET integrated database retrieval system