KEGG   Homo sapiens (human): 5527Help
Entry
5527              CDS       T01001                                 

Gene name
PPP2R5C, B56G, B56gamma, PR61G
Definition
(RefSeq) protein phosphatase 2 regulatory subunit B'gamma
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04728  Dopaminergic synapse
hsa05165  Human papillomavirus infection
Network
N00195  HPV E7 to host-cell-protein inhibition
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    5527 (PPP2R5C)
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    5527 (PPP2R5C)
   04151 PI3K-Akt signaling pathway
    5527 (PPP2R5C)
   04152 AMPK signaling pathway
    5527 (PPP2R5C)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    5527 (PPP2R5C)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5527 (PPP2R5C)
  Nervous system
   04728 Dopaminergic synapse
    5527 (PPP2R5C)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    5527 (PPP2R5C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5527 (PPP2R5C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5527 (PPP2R5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: B56 MvaI_BcnI DUF1616
Motif
Other DBs
NCBI-GeneID: 5527
NCBI-ProteinID: NP_002710
OMIM: 601645
HGNC: 9311
Ensembl: ENSG00000078304
Vega: OTTHUMG00000171597
Pharos: Q13362(Tbio)
UniProt: Q13362
Structure
PDB: 

Position
14q32.31
AA seq 524 aa AA seqDB search
MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPL
SDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDP
EEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERD
FLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLK
EEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPK
EVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLIS
DNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK
LKMKEREEAWVKIENLAKANPQYTVYSQASTMSIPVAMETDGPLFEDVQMLRKTVKDEAH
QAQKDPKKDRPLARRKSELPQDPHTKKALEAHCRADELASQDGR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttgacatgtaataaagcgggcagcaggatggtggtggatgcggccaactccaatggg
cctttccagcccgtggtccttctccatattcgagatgttcctcctgctgatcaagagaag
ctttttatccagaagttacgtcagtgttgcgtcctctttgactttgtttctgatccacta
agtgacctaaagtggaaggaagtaaaacgagctgctttaagtgaaatggtagaatatatc
acccataatcggaatgtgatcacagagcctatttacccagaagtagtccatatgtttgca
gttaacatgtttcgaacattaccaccttcctccaatcctacgggagcggaatttgacccg
gaggaagatgaaccaacgttagaagcagcctggcctcatctacagcttgtttatgaattt
ttcttaagatttttagagtctccagatttccaacctaatatagcgaagaaatatattgat
cagaagtttgtattgcagcttttagagctctttgacagtgaagatcctcgggagagagat
tttcttaaaaccacccttcacagaatctatgggaaattcctaggcttgagagcttacatc
agaaaacagataaataatatattttataggtttatttatgaaacagagcatcataatggc
atagcagagttactggaaatattgggaagtataattaatggatttgccttaccactaaaa
gaagagcacaagattttcttattgaaggtgttactacctttgcacaaagtgaaatctctg
agtgtctaccatccccagctggcatactgtgtagtgcagtttttagaaaaggacagcacc
ctcacggaaccagtggtgatggcacttctcaaatactggccaaagactcacagtccaaaa
gaagtaatgttcttaaacgaattagaagagattttagatgtcattgaaccatcagaattt
gtgaagatcatggaacccctcttccggcagttggccaaatgtgtctccagcccacacttc
caggtggcagagcgagctctctattactggaataatgaatacatcatgagtttaatcagt
gacaacgcagcgaagattctgcccatcatgtttccttccttgtaccgcaactcaaagacc
cattggaacaagacaatacatggcttgatatacaacgccctgaagctcttcatggagatg
aaccaaaagctatttgatgactgtacacaacagttcaaagcagagaaactaaaagagaag
ctaaaaatgaaagaacgggaagaagcatgggttaaaatagaaaatctagccaaagccaat
ccccagtacacagtgtatagtcaagccagcaccatgagcattccggttgcaatggagaca
gatgggcctttatttgaagatgtgcagatgctgagaaagacagtgaaggacgaggctcat
caggcacagaaagatccgaagaaggaccgtcctcttgcacgccgcaagtccgagctgcct
caggacccccacaccaagaaagccttggaagctcactgcagggccgatgagctggcctcc
caggacggccgctag

DBGET integrated database retrieval system