KEGG   Homo sapiens (human): 55274Help
Entry
55274             CDS       T01001                                 

Gene name
PHF10, BAF45A, XAP135
Definition
(RefSeq) PHD finger protein 10
  KO
K22197  BRG1-associated factor 45A
Organism
hsa  Homo sapiens (human)
Pathway
hsa05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers
   05225 Hepatocellular carcinoma
    55274 (PHF10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD PHD_4 PHD_2 Herpes_MCP
Motif
Other DBs
NCBI-GeneID: 55274
NCBI-ProteinID: NP_060758
OMIM: 613069
HGNC: 18250
Ensembl: ENSG00000130024
Vega: OTTHUMG00000016058
Pharos: Q8WUB8(Tdark)
UniProt: Q8WUB8
Position
6q27
AA seq 498 aa AA seqDB search
MAAAAGPGAALSPRPCDSDPATPGAQSPKDDNEDNSNDGTQPSKRRRMGSGDSSRSCETS
SQDLGFSYYPAENLIEYKWPPDETGEYYMLQEQVSEYLGVTSFKRKYPDLERRDLSHKEK
LYLRELNVITETQCTLGLTALRSDEVIDLMIKEYPAKHAEYSVILQEKERQRITDHYKEY
SQMQQQNTQKVEASKVPEYIKKAAKKAAEFNSNLNRERMEERRAYFDLQTHVIQVPQGKY
KVLPTERTKVSSYPVALIPGQFQEYYKRYSPDELRYLPLNTALYEPPLDPELPALDSDGD
SDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKR
SVLSKSVPGYKPKVIPNAICGICLKGKESNKKGKAESLIHCSQCENSGHPSCLDMTMELV
SMIKTYPWQCMECKTCIICGQPHHEEEMMFCDMCDRGYHTFCVGLGAIPSGRWICDCCQR
APPTPRKVGRRGKNSKEG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggccgggcccggggctgcgctgtccccgcggccgtgcgacagcgaccca
gccacccccggagcgcagtccccgaaggatgataatgaagataattcaaatgatgggacc
cagccatccaaaaggaggcgaatgggctcaggagatagttctaggagttgtgaaacttca
agtcaagatcttggttttagttactatccagcagaaaacttgatagagtacaaatggcca
cctgatgaaacaggagaatactatatgcttcaagaacaagtcagtgaatatttgggtgtg
acctcctttaaaaggaaatatccagatttagagcgacgagatttgtctcacaaggagaaa
ctctacctgagagagctaaatgtcattactgaaactcagtgcactctaggcttaacagca
ttgcgcagtgatgaagtgattgatttaatgataaaagaatatccagccaaacatgctgag
tattctgttattctacaagaaaaagaacgtcaacgaattacagaccattataaagagtat
tcccaaatgcaacaacagaatactcagaaagttgaagccagtaaagtgcctgagtatatt
aagaaagctgccaaaaaagcagcagaatttaatagcaacttaaaccgggaacgcatggaa
gaaagaagagcttattttgacttgcagacacatgttatccaggtacctcaagggaagtac
aaagttttgccaacagagcgaacaaaggtcagttcttacccagtggctctcatccccgga
cagttccaggaatattataagaggtactcaccagatgagctgcggtatctgccattaaac
acagccctgtatgagccccctctggatcctgagctccctgctctagacagtgatggtgat
tcagatgatggcgaagatggtcgaggtgatgagaaacggaaaaataaaggcacttcggac
agctcctctggcaatgtatctgaaggggaaagccctcctgacagccaggaggactctttc
cagggaagacagaaatcaaaagacaaagctgccactccaagaaaagatggtcccaaacgt
tctgtactgtccaagtcagttcctgggtacaagccaaaggtcattccaaatgctatatgt
ggaatttgtctgaagggtaaggagtccaacaagaaaggaaaggctgaatcacttatacac
tgctcccaatgtgagaatagtggccatccttcttgcctggatatgacaatggagcttgtt
tctatgattaagacctacccatggcagtgtatggaatgtaaaacatgcattatatgtgga
caaccccaccatgaagaagaaatgatgttctgtgatatgtgtgacagaggttatcatact
ttttgtgtgggccttggtgctattccatcaggtcgctggatttgtgactgttgtcagcgg
gcccccccaacacccaggaaagtgggcagaagggggaaaaacagcaaagagggataa

DBGET integrated database retrieval system