KEGG   Homo sapiens (human): 5528Help
Entry
5528              CDS       T01001                                 

Gene name
PPP2R5D, B56D, B56delta, MRD35
Definition
(RefSeq) protein phosphatase 2 regulatory subunit B'delta
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04728  Dopaminergic synapse
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Disease
H00773  Autosomal dominant mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5528 (PPP2R5D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    5528 (PPP2R5D)
   04151 PI3K-Akt signaling pathway
    5528 (PPP2R5D)
   04152 AMPK signaling pathway
    5528 (PPP2R5D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5528 (PPP2R5D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5528 (PPP2R5D)
  09156 Nervous system
   04728 Dopaminergic synapse
    5528 (PPP2R5D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5528 (PPP2R5D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5528 (PPP2R5D)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5528 (PPP2R5D)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5528 (PPP2R5D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5528 (PPP2R5D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: B56 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 5528
NCBI-ProteinID: NP_006236
OMIM: 601646
HGNC: 9312
Ensembl: ENSG00000112640
Vega: OTTHUMG00000014716
Pharos: Q14738(Tbio)
UniProt: Q14738 A0A024RD11
Position
6p21.1
AA seq 602 aa AA seqDB search
MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPS
NSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQ
KLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLF
RTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFV
LALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAEL
LEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEP
VIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAE
RALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKL
FDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPT
AEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQE
AL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgccctataaactgaaaaaggagaaggagccccccaaggttgccaaatgcacagccaag
cctagcagctcgggcaaggatggtggaggcgagaacactgaggaggcccagccgcagccc
cagccccagccccagccccaagcccagtctcagccaccgtcatccaacaagcgtcccagc
aatagcacgccgccccccacgcagctcagcaaaatcaagtactcaggggggccccagatt
gtcaagaaggagcgacggcaaagctcctcccgcttcaacctcagcaagaatcgggagctg
cagaagcttcctgccctgaaagattcgccaacccaggagcgggaggagctgtttatccag
aagctacgccagtgctgtgtcctctttgacttcgtgtcagacccactcagtgacctcaaa
ttcaaggaggtgaagcgggcaggactcaacgagatggtggagtacatcacccatagccgt
gatgttgtcactgaggccatttaccctgaggctgtcaccatgttttcagtgaacctcttc
cggacgctgccaccttcatcgaatcccacaggggctgagtttgacccagaggaagatgag
cccaccctggaagctgcttggccacatctccagctcgtgtatgagttcttcttacgtttc
cttgagtctcctgatttccagccaaacatagccaagaagtacatcgaccagaagtttgta
cttgctctcctagacctatttgacagtgaggatcctcgagagcgggacttcctcaagacc
attttgcatcgcatctatggcaagtttttggggctccgggcttatatccgtaggcagatc
aaccacatcttctacaggttcatctacgagacggagcatcacaacgggattgctgagctc
ctggagatcctgggcagcatcatcaatggctttgccctgccccttaaagaagagcacaag
atgttcctcatccgtgtcctacttccccttcacaaggtcaagtccctgagtgtctaccac
cctcagctggcatactgtgtggtacaattcctggagaaggagagcagtctgactgagccg
gtaattgtgggacttctcaagttttggcccaagacccacagccccaaggaggtgatgttc
ttgaatgagctggaggagattctggacgtcattgaaccttctgagttcagcaaagtgatg
gaacccctcttccgccagctggccaagtgtgtctctagcccccatttccaggtggcagag
cgtgctctctattactggaacaatgagtacatcatgagcctgataagtgacaatgctgcc
cgagtcctccccatcatgttccctgcactctacaggaactccaagagccactggaacaag
acaatccatggactgatctataatgccctgaagttgtttatggaaatgaatcagaagctg
tttgatgactgcacacaacaatacaaggcagagaagcagaagggccggttccgaatgaag
gaaagggaagagatgtggcaaaaaatcgaggagctggcccggcttaatccccagtatccc
atgttccgagcccctccaccactgccccctgtgtactcgatggagacagagacccccaca
gctgaggacatccagcttctgaagaggactgtggagactgaggctgttcagatgctaaaa
gacatcaagaaggagaaagtgctgctgcggaggaagtcggagctgccccaggacgtgtac
accatcaaggcactggaggcgcacaagcgggcggaagagttcctaactgccagccaggag
gctctctga

DBGET integrated database retrieval system