KEGG   Homo sapiens (human): 55283
Entry
55283             CDS       T01001                                 

Gene name
MCOLN3, TRP-ML3, TRPML3
Definition
(RefSeq) mucolipin TRP cation channel 3
  KO
K04994  mucolipin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    55283 (MCOLN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    55283 (MCOLN3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   55283 (MCOLN3)
SSDB
Motif
Pfam: PKD_channel Ion_trans
Other DBs
NCBI-GeneID: 55283
NCBI-ProteinID: NP_060768
OMIM: 607400
HGNC: 13358
Ensembl: ENSG00000055732
Vega: OTTHUMG00000009955
Pharos: Q8TDD5(Tbio)
UniProt: Q8TDD5
Structure
PDB: 
6AYF 6AYE 6AYG

Position
1p22.3
AA seq 553 aa
MADPEVVVSSCSSHEEENRCNFNQQTSPSEELLLEDQMRRKLKFFFMNPCEKFWARGRKP
WKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMDDTYAVYTQS
DVYDQLIFAVNQYLQLYNVSVGNHAYENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPE
IETECFFVEPDEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYD
FTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQKNTHYMMIFDAFVILTCLVSL
ILCIRSVIRGLQLQQEFVNFFLLHYKKEVSVSDQMEFVNGWYIMIIISDILTIIGSILKM
EIQAKSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVIRFCCCAA
MIYLGYCFCGWIVLGPYHDKFRSLNMVSECLFSLINGDDMFATFAKMQQKSYLVWLFSRI
YLYSFISLFIYMILSLFIALITDTYETIKQYQQDGFPETELRTFISECKDLPNSGKYRLE
DDPPVSLFCCCKK
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggcagatcctgaggtagttgtgagtagctgcagctctcatgaagaggaaaatcgctgc
aattttaaccagcaaacatctccatctgaggagcttctattagaagaccagatgaggcga
aaactcaaattttttttcatgaatccctgtgagaagttctgggctcgaggtagaaaacca
tggaaacttgccatacaaattctaaaaattgcaatggtgactatccagctggtcttattt
gggctaagtaaccagatggtggtagctttcaaggaagagaatactatagcattcaaacac
cttttcctaaaaggatatatggaccgaatggatgacacatatgcagtgtacacacaaagt
gacgtgtatgatcagttaatcttcgcagtaaaccagtacttgcagctatacaatgtctcc
gttgggaatcatgcttatgagaacaaaggtaccaagcaatctgctatggcaatctgtcag
cacttctacaagcgaggaaacatctaccctggaaatgatacctttgacatcgatccagaa
attgaaactgagtgtttctttgtggagccagatgaaccttttcacattgggacaccagca
gaaaataaactgaacttaacactggacttccacagactcctaacagtggagcttcagttt
aaactgaaagccattaatctgcagacagttcgtcatcaagaactccctgactgttatgac
tttactctgactataacatttgacaacaaggcccatagtggaagaattaaaataagttta
gataatgacatttccatcagagaatgtaaagactggcatgtatctggatcaattcagaag
aacactcattacatgatgatctttgatgcctttgtcattctgacttgcttggtttcatta
atcctctgcattagatctgtgattagaggacttcagcttcagcaggagtttgtcaatttt
ttcctcctccattataagaaggaagtttctgtttctgatcaaatggaatttgtcaatgga
tggtacattatgattattattagtgacatattgacaatcattggatcaattctaaaaatg
gaaatccaagctaagagtctaactagttatgatgtctgtagcatacttcttgggacttct
accatgctcgtgtggcttggagtcatccgatacctcggtttctttgcaaagtacaacctc
ctcattttgacccttcaggcagcgctgcccaatgtcatcaggttctgctgctgtgcagct
atgatttacttaggttactgcttctgtggatggatcgtgctggggccttaccatgacaag
tttcgttctctgaacatggtctctgagtgccttttctctctgataaatggagatgatatg
tttgccacgtttgcaaaaatgcagcaaaaaagttacttagtctggctgtttagtagaatt
tacctctactcattcatcagcctctttatatatatgattttaagtcttttcattgcactg
atcactgatacatacgaaacaattaagcaataccaacaagatggcttcccagagactgaa
cttcgtacatttatatcagaatgcaaagatctacccaactctggaaaatacagattagaa
gatgaccctccagtatctttattctgctgttgtaaaaagtag

DBGET integrated database retrieval system