KEGG   Homo sapiens (human): 55289
Entry
55289             CDS       T01001                                 

Gene name
ACOXL
Definition
(RefSeq) acyl-CoA oxidase like
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1
Other DBs
NCBI-GeneID: 55289
NCBI-ProteinID: NP_001136279
HGNC: 25621
Ensembl: ENSG00000153093
Vega: OTTHUMG00000131257
Pharos: Q9NUZ1(Tdark)
UniProt: Q9NUZ1 B4DU63
Position
2q13
AA seq 580 aa
MRALTVQRVKFAMDLPLLKRAGQDLAEKTKNFVSRSLVIGEVLSMADMATGVKCGIIYWL
FGGAIRNLGSPEHVTKWFQPLQEQKYTGMFAMTERGHGSNARGIQTEATFDLSAQEFVID
TPCENAEKMYIGNAMYGNYAAVFAQLIIDGRSQGPHCFIVPVRDENGSLYPGVTAIDMMY
KEGLHGVDNGILIFDKVRIPRENLLDKFGSVAPDGQYHSPIRNKSARFNAMLAALTPSRL
AVAFQAMGAMKLGLTIAIRYSHSRRQFGPKTKEEVKIIEHQTQTLRLMPHLATALALTFV
SRYAGALLDEDVFQGKELVNSRSLQALVAGLKAYSTWENIRCLQDCRECTGGMVVGRELL
AQYTKQYEEKPLFGLLQNWAESVGDKLRTSFLAFNMDTVDDLAFLLKAVKFRERVLQRGL
VARIYYKVKTKKEDFFHAWNSCLHHVASLSLAHTHRVTLEQFSLAVKSCPDQEDQTLLMK
FCLLYGTKLVFQERAWYLEHKYLTPMASTRIRNQLLDLCDSVKDDARRVISTFNIPHTYL
HAPIAGISNPRAAWAFYPAPLQPRPREEARSRRPKLGAKL
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgagagctttgacagttcagagagtgaagtttgccatggacctgcctctgttaaaacgt
gcaggtcaggatctggcagagaaaacaaagaattttgtcagccgaagccttgtcatagga
gaagtcctctccatggcggacatggccacaggagtgaagtgcggaataatttattggcta
tttggtggtgctatcaggaatctcggaagccctgaacatgttactaagtggtttcagcca
ctccaggagcagaaatacactgggatgtttgcaatgaccgagaggggccatgggagcaac
gcgagagggatccagaccgaagccacctttgacctctctgcccaggagtttgtaattgac
acgccgtgtgaaaatgcggagaagatgtatattggaaatgccatgtacgggaattatgca
gctgtctttgcccagctcatcatagatggaagatctcaagggccccactgtttcatcgtt
cctgtccgggatgaaaacggaagcttgtacccaggagtcacagctattgatatgatgtac
aaggagggtctgcatggtgtggacaatgggatattaatatttgacaaggttcggataccc
agggagaacctgctggataagtttggttccgtggctccagatggacagtaccattcgcct
attaggaacaagagtgcaagattcaatgccatgctggcagcactgaccccttcgagatta
gctgtggctttccaagctatgggtgccatgaagcttgggttgacgatagccattcgctat
agccacagccggaggcagtttgggcccaaaaccaaggaagaggtgaagatcattgagcac
caaacacagaccctgcggctgatgccccacctggccacagccttggccctgaccttcgtc
agcaggtatgctggggccctcctggatgaggatgtcttccagggaaaggagctggtcaac
agtcgctcgctgcaggctctggtggcggggctgaaggcctacagcacctgggagaacatc
cgctgcctgcaggactgccgcgagtgcactggaggcatggttgtggggcgggaactgctg
gcccaatacaccaaacagtatgaagaaaaaccactctttggcctgctccaaaactgggct
gaatctgtgggggacaagctgagaaccagtttcctggcatttaacatggacacagttgat
gatctcgcctttctgttgaaagcagtgaaatttcgtgaaagggttcttcagcggggtttg
gtggccagaatttattataaggtaaagaccaagaaggaggattttttccatgcctggaac
tcgtgtctgcaccacgtggcttctctgtccctggcacacactcaccgagttaccttagag
cagttctccctagcagtgaagagctgtcctgaccaagaggaccagactttgttaatgaag
ttttgtctgttgtatggaaccaagctggtgtttcaggagcgggcctggtatttagaacat
aaatacttgactcccatggccagcacgaggatcaggaatcagttgctggatttgtgcgac
tcggtgaaggatgatgcccggagggtgatctcgacctttaacattccacacacctacctc
cacgcaccaatcgccggaatctccaacccgcgggccgcgtgggctttctaccctgcaccg
ctgcagccgcggccacgggaagaggcgcgctcccggcggcccaagctgggagccaagctc
taa

DBGET integrated database retrieval system