KEGG   Homo sapiens (human): 55297
Entry
55297             CDS       T01001                                 
Symbol
CCDC91, HSD8, p56
Name
(RefSeq) coiled-coil domain containing 91
Organism
hsa  Homo sapiens (human)
SSDB
Other DBs
NCBI-GeneID: 55297
NCBI-ProteinID: NP_060788
OMIM: 617366
HGNC: 24855
Ensembl: ENSG00000123106
Pharos: Q7Z6B0(Tdark)
UniProt: Q7Z6B0 A0A024RAW6 Q05D28
Structure
Position
12:28190456..28550166
AA seq 441 aa
MDDDDFGGFEAAETFDGGSGETQTTSPAIPWAAFPAVSGVHLSPSSPEIVLDRDHSSSIG
CLSSDAIISSPENTHAANSIVSQTIPKAQIQQSTHTHLDISLFPLGLTDEKSNGTIALVD
DSEDPGANVSNIQLQQKISSLEIKLKVSEEEKQRIKQDVESLMEKHNVLEKGFLKEKEQE
AISFQDRYKELQEKHKQELEDMRKAGHEALSIIVDEYKALLQSSVKQQVEAIEKQYISAI
EKQAHKCEELLNAQHQRLLEMLDTEKELLKEKIKEALIQQSQEQKEILEKCLEEERQRNK
EALVSAAKLEKEAVKDAVLKVVEEERKNLEKAHAEERELWKTEHAKDQEKVSQEIQKAIQ
EQRKISQETVKAAIIEEQKRSEKAVEEAVKRTRDELIEYIKEQKRLDQVIRQRSLSSLEL
FLSCAQKQLSALIATEPVDIE
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggatgatgatgattttggtggttttgaggctgcggagacttttgatggtggaagtggt
gaaacccaaacaacatctcctgctattccttgggctgcctttcctgcagtatctggagtc
catctttcaccatcttctcctgagattgtactggaccgtgaccactcttcttccattggc
tgcctctcttctgatgccattatttcatcaccagagaatacacatgcagcaaatagcatt
gtgagtcaaactattccaaaagcacagattcagcaatcaacacacactcatctggatatc
tcactttttccattgggtttaactgatgaaaaaagtaatggaacaattgcccttgtggat
gattctgaggatcctggagccaatgtatctaacatacagcttcagcaaaaaatttcaagt
ctggagattaaactcaaagtatctgaagaagaaaaacagagaattaaacaggatgtggaa
tcattgatggaaaagcataatgtcttagaaaaaggctttctaaaagaaaaagagcaagag
gccatttcttttcaagatagatacaaagaacttcaggaaaaacataaacaagaattggaa
gacatgaggaaagctggtcacgaagccctcagcattattgtggatgaatataaggcacta
ctgcagtcttcagttaagcaacaagtagaagctattgaaaaacagtacatttctgcaatt
gagaaacaggcacacaagtgtgaggagttgctaaatgctcagcatcagaggctccttgaa
atgctagatacagagaaggaactgttaaaagaaaaaataaaggaagctttgattcagcaa
tctcaagaacagaaggaaatattggaaaagtgtttggaggaagaaaggcaaagaaataaa
gaggcattagtatccgctgcaaagcttgaaaaagaagcagtgaaggatgcagttttaaaa
gtcgtagaagaagaaagaaaaaatttagaaaaagcgcatgctgaagaaagggaattatgg
aagacagaacatgcaaaagatcaagaaaaagtatctcaggaaattcaaaaagctatacaa
gaacaaagaaaaataagtcaggaaactgttaaggcagcaataatagaagagcagaaacga
agtgaaaaggctgtggaagaggcagtgaaaagaacaagagatgaattgatagagtatata
aaagaacagaaaaggctcgatcaagtcatccgccaaagaagcctgtccagtttggaactg
ttcctctcctgtgcacagaaacagttaagtgctttaatagctacggaaccagttgacatt
gaataa

DBGET integrated database retrieval system