KEGG   Homo sapiens (human): 5530Help
Entry
5530              CDS       T01001                                 

Gene name
PPP3CA, CALN, CALNA, CALNA1, CCN1, CNA1, IECEE, IECEE1, PPP2B
Definition
(RefSeq) protein phosphatase 3 catalytic subunit alpha
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04720  Long-term potentiation
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05031  Amphetamine addiction
hsa05152  Tuberculosis
hsa05163  Human cytomegalovirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00180  KSHV K1 to PLCG-calcineurin signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
Disease
H02150  Infantile or early childhood epileptic encephalopathy
Drug target
Ciclosporin: D00184
Pimecrolimus: D05480
Ruclosporin: D10983
Tacrolimus (DG00439): D00107 D08556
Voclosporin: D09033
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5530 (PPP3CA)
   04310 Wnt signaling pathway
    5530 (PPP3CA)
   04370 VEGF signaling pathway
    5530 (PPP3CA)
   04020 Calcium signaling pathway
    5530 (PPP3CA)
   04022 cGMP - PKG signaling pathway
    5530 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5530 (PPP3CA)
   04218 Cellular senescence
    5530 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    5530 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    5530 (PPP3CA)
   04660 T cell receptor signaling pathway
    5530 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    5530 (PPP3CA)
   04659 Th17 cell differentiation
    5530 (PPP3CA)
   04662 B cell receptor signaling pathway
    5530 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5530 (PPP3CA)
   04921 Oxytocin signaling pathway
    5530 (PPP3CA)
   04924 Renin secretion
    5530 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    5530 (PPP3CA)
   04728 Dopaminergic synapse
    5530 (PPP3CA)
   04720 Long-term potentiation
    5530 (PPP3CA)
  09158 Development
   04360 Axon guidance
    5530 (PPP3CA)
   04380 Osteoclast differentiation
    5530 (PPP3CA)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    5530 (PPP3CA)
   05014 Amyotrophic lateral sclerosis (ALS)
    5530 (PPP3CA)
  09164 Substance dependence
   05031 Amphetamine addiction
    5530 (PPP3CA)
  09167 Infectious diseases
   05152 Tuberculosis
    5530 (PPP3CA)
   05166 HTLV-I infection
    5530 (PPP3CA)
   05163 Human cytomegalovirus infection
    5530 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5530 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    5530 (PPP3CA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5530 (PPP3CA)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     5530 (PPP3CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos DUF5378
Motif
Other DBs
NCBI-GeneID: 5530
NCBI-ProteinID: NP_000935
OMIM: 114105
HGNC: 9314
Ensembl: ENSG00000138814
Vega: OTTHUMG00000133839
Pharos: Q08209(Tchem)
UniProt: Q08209 A0A0S2Z4C6
Structure
PDB: 

Position
4q24
AA seq 521 aa AA seqDB search
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gttccatttcctccaagtcaccggcttacagcaaaagaagtgtttgataatgatggaaaa
cctcgtgtggatatcttaaaggcgcatcttatgaaggagggaaggctggaagagagtgtt
gcattgagaataataacagagggtgcatcaattcttcgacaggaaaaaaatttgctggat
attgatgcgccagtcactgtttgtggggacattcatggacaattctttgatttgatgaag
ctctttgaagtcgggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtattgaatgtgtgctgtatttgtgggccttgaaaattctctac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgcgtatatgatgcctgtatggat
gcctttgactgccttcccctggctgccctgatgaaccaacagttcctgtgtgtgcatggt
ggtttgtctccagagattaacactttagatgatatcagaaaattagaccgattcaaagaa
ccacctgcatatggacctatgtgtgatatcctgtggtcagaccccctggaagattttgga
aatgagaagactcaggaacatttcactcacaacacagtcagggggtgttcatacttctac
agttacccggctgtatgtgaattcttacagcacaataacttgttatctatactccgagcc
cacgaagcccaagatgcagggtaccgcatgtacaggaaaagccaaacaacaggcttccct
tctctaattacaattttttcagcaccaaattacttagatgtatacaataacaaagctgca
gtattgaagtatgagaacaatgttatgaatatcaggcaattcaactgttctcctcatcca
tactggcttccaaatttcatggatgtttttacttggtcccttccatttgttggggaaaaa
gtgactgagatgctggtaaatgtcctcaacatctgctcagatgatgaactagggtcagaa
gaagatggatttgatggtgcaacagctgcagcccggaaagaggtgataaggaacaagatc
cgagcaataggcaaaatggccagagtgttctcagtgctcagagaagagagtgagagtgtg
ctgacgctgaaaggcttgaccccaactggcatgctccccagcggagtactttctggaggg
aagcaaaccctgcaaagcgctactgttgaggctattgaggctgatgaagctatcaaagga
ttttcaccacaacataagatcactagcttcgaggaagccaagggcttagaccgaattaat
gagaggatgccgcctcgcagagatgccatgccctctgacgccaaccttaactccatcaac
aaggctctcacctcagagactaacggcacggacagcaatggcagtaatagcagcaatatt
cagtga

KEGG   Homo sapiens (human): 5532Help
Entry
5532              CDS       T01001                                 

Gene name
PPP3CB, CALNA2, CALNB, CNA2, PP2Bbeta
Definition
(RefSeq) protein phosphatase 3 catalytic subunit beta
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04720  Long-term potentiation
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05031  Amphetamine addiction
hsa05152  Tuberculosis
hsa05163  Human cytomegalovirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00180  KSHV K1 to PLCG-calcineurin signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
Drug target
Ciclosporin: D00184
Pimecrolimus: D05480
Ruclosporin: D10983
Tacrolimus (DG00439): D00107 D08556
Voclosporin: D09033
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5532 (PPP3CB)
   04310 Wnt signaling pathway
    5532 (PPP3CB)
   04370 VEGF signaling pathway
    5532 (PPP3CB)
   04020 Calcium signaling pathway
    5532 (PPP3CB)
   04022 cGMP - PKG signaling pathway
    5532 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5532 (PPP3CB)
   04218 Cellular senescence
    5532 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    5532 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    5532 (PPP3CB)
   04660 T cell receptor signaling pathway
    5532 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    5532 (PPP3CB)
   04659 Th17 cell differentiation
    5532 (PPP3CB)
   04662 B cell receptor signaling pathway
    5532 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5532 (PPP3CB)
   04921 Oxytocin signaling pathway
    5532 (PPP3CB)
   04924 Renin secretion
    5532 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    5532 (PPP3CB)
   04728 Dopaminergic synapse
    5532 (PPP3CB)
   04720 Long-term potentiation
    5532 (PPP3CB)
  09158 Development
   04360 Axon guidance
    5532 (PPP3CB)
   04380 Osteoclast differentiation
    5532 (PPP3CB)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    5532 (PPP3CB)
   05014 Amyotrophic lateral sclerosis (ALS)
    5532 (PPP3CB)
  09164 Substance dependence
   05031 Amphetamine addiction
    5532 (PPP3CB)
  09167 Infectious diseases
   05152 Tuberculosis
    5532 (PPP3CB)
   05166 HTLV-I infection
    5532 (PPP3CB)
   05163 Human cytomegalovirus infection
    5532 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5532 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    5532 (PPP3CB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5532 (PPP3CB)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     5532 (PPP3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos DUF5378
Motif
Other DBs
NCBI-GeneID: 5532
NCBI-ProteinID: NP_066955
OMIM: 114106
HGNC: 9315
Ensembl: ENSG00000107758
Vega: OTTHUMG00000018472
Pharos: P16298(Tbio)
UniProt: P16298
Structure
PDB: 

Position
10q22.2
AA seq 524 aa AA seqDB search
MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFS
VLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFE
EAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggccgccccggagccggcccgggctgcaccgcccccacccccgcccccgccgccccct
cccggggctgaccgcgtcgtcaaagctgtccctttccccccaacacatcgcttgacatct
gaagaagtatttgatttggatgggatacccagggttgatgttctgaagaaccacttggtg
aaagaaggtcgagtagatgaagaaattgcgcttagaattatcaatgagggtgctgccatc
cttcggagagagaaaaccatgatagaagtagaagctccaatcacagtgtgtggtgacatc
catggccaattttttgatctgatgaaactttttgaagtaggaggatcacctgctaataca
cgatacctttttcttggcgattatgtggacagaggttattttagtatagagtgtgtctta
tatttatgggttctgaagattctatacccaagcacattatttcttctgagaggcaaccat
gaatgcagacaccttactgaatattttacctttaagcaggaatgtaaaattaagtattcg
gaaagagtctatgaagcttgtatggaagcttttgatagtttgcctcttgctgcactttta
aaccaacagtttctttgtgttcatggtggactttcaccagaaatacacacactggatgat
attaggagattagatagattcaaagagccacctgcatttggaccaatgtgtgacttgtta
tggtccgatccttctgaagattttggaaatgaaaaatcacaggaacattttagtcacaat
acagttcgaggatgttcttatttttataactatccagcagtgtgtgaatttttgcaaaac
aataatttgttatcgattattagagctcatgaagctcaagatgcaggctatagaatgtac
agaaaaagtcaaactacagggttcccttcattaataacaattttttcggcacctaattac
ttagatgtctacaataataaagctgctgtattaaagtatgaaaataatgtgatgaatatt
cgacagtttaactgttctccacatccttactggttgcctaattttatggatgtcttcacg
tggtctttaccgtttgttggagaaaaagtgacagaaatgttggtaaatgttctgagtatt
tgctctgatgatgaactaatgactgaaggtgaagaccagtttgatggttcagctgcagcc
cggaaagaaatcataagaaacaaaattcgagcaattggcaagatggcaagagtcttctct
gttctcagggaggagagtgaaagtgtgctgacactcaagggcctgactcccacagggatg
ttgcctagtggagtgttagctggaggacggcagaccctgcaaagtgccacagttgaggct
attgaggctgaaaaagcaatacgaggattctctccaccacatagaatctgcagttttgaa
gaggcaaagggtttggataggatcaatgagagaatgccacctcggaaagatgctgtacag
caagatggtttcaattctctgaacaccgcacatgccactgagaaccacgggacgggcaac
catactgcccagtga

KEGG   Homo sapiens (human): 5533Help
Entry
5533              CDS       T01001                                 

Gene name
PPP3CC, CALNA3, CNA3, PP2Bgamma
Definition
(RefSeq) protein phosphatase 3 catalytic subunit gamma
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04720  Long-term potentiation
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05031  Amphetamine addiction
hsa05152  Tuberculosis
hsa05163  Human cytomegalovirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00180  KSHV K1 to PLCG-calcineurin signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
Drug target
Ciclosporin: D00184
Pimecrolimus: D05480
Ruclosporin: D10983
Tacrolimus (DG00439): D00107 D08556
Voclosporin: D09033
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5533 (PPP3CC)
   04310 Wnt signaling pathway
    5533 (PPP3CC)
   04370 VEGF signaling pathway
    5533 (PPP3CC)
   04020 Calcium signaling pathway
    5533 (PPP3CC)
   04022 cGMP - PKG signaling pathway
    5533 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5533 (PPP3CC)
   04218 Cellular senescence
    5533 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    5533 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    5533 (PPP3CC)
   04660 T cell receptor signaling pathway
    5533 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    5533 (PPP3CC)
   04659 Th17 cell differentiation
    5533 (PPP3CC)
   04662 B cell receptor signaling pathway
    5533 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5533 (PPP3CC)
   04921 Oxytocin signaling pathway
    5533 (PPP3CC)
   04924 Renin secretion
    5533 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    5533 (PPP3CC)
   04728 Dopaminergic synapse
    5533 (PPP3CC)
   04720 Long-term potentiation
    5533 (PPP3CC)
  09158 Development
   04360 Axon guidance
    5533 (PPP3CC)
   04380 Osteoclast differentiation
    5533 (PPP3CC)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    5533 (PPP3CC)
   05014 Amyotrophic lateral sclerosis (ALS)
    5533 (PPP3CC)
  09164 Substance dependence
   05031 Amphetamine addiction
    5533 (PPP3CC)
  09167 Infectious diseases
   05152 Tuberculosis
    5533 (PPP3CC)
   05166 HTLV-I infection
    5533 (PPP3CC)
   05163 Human cytomegalovirus infection
    5533 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5533 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    5533 (PPP3CC)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5533 (PPP3CC)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     5533 (PPP3CC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Motif
Other DBs
NCBI-GeneID: 5533
NCBI-ProteinID: NP_005596
OMIM: 114107
HGNC: 9316
Ensembl: ENSG00000120910
Vega: OTTHUMG00000163802
Pharos: P48454(Tbio)
UniProt: P48454
Position
8p21.3
AA seq 512 aa AA seqDB search
MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTDYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNVLNICSDDELISDDEAEGSTTVRKEIIRNKIRAIGKMARVFSILRQESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHKIRSFEEARGLDRINERMPPR
KDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggaggcgcttccacctctccaccaccgaccgcgtcatcaaagctgtccccttt
cctccaacccaacggcttactttcaaggaagtatttgagaatgggaaacctaaagttgat
gttttaaaaaaccatttggtaaaggaaggacgactggaagaggaagtagccttaaagata
atcaatgatggggctgccatcctgaggcaagagaagactatgatagaagtagatgctcca
atcacagtatgtggtgatattcatggacaattctttgacctaatgaagttatttgaagtt
ggaggatcacctagtaacacacgctacctctttctgggtgactatgtggacagaggctat
ttcagtatagagtgtgtgctgtatttatggagtttaaagattaatcatcccaaaacattg
tttctgcttcggggaaatcatgaatgcaggcatcttacagactatttcaccttcaaacag
gaatgtcgaatcaaatattcggaacaggtgtatgatgcctgtatggagacatttgactgt
cttcctcttgctgccctcttaaaccagcagtttctctgtgtacatggaggaatgtcacct
gaaattacttctttagatgacattaggaaattagacaggtttacggaacctcccgccttt
ggacctgtgtgtgacctgctttggtctgatccctcagaggattatggcaatgagaagacc
ttggagcactatacccacaacactgtccgagggtgctcttatttctacagttaccctgca
gtttgtgaatttttgcagaacaataatttactatcaattatcagagcccatgaagcccaa
gatgctgggtatcgaatgtacaggaagagccaagccacaggctttccatcacttattaca
attttctctgcccccaattacctagatgtctataacaataaagctgctgtgttgaaatat
gaaaacaatgtcatgaatatcaggcagtttaactgttctccacacccctactggcttcca
aactttatggatgttttcacatggtctttgccttttgttggggaaaaagtcacagagatg
ctggtaaatgtgctcaacatatgctctgatgacgaactgatttctgatgatgaagcagaa
ggaagcactacagttcgtaaggagatcatcaggaataagatcagagccattgggaagatg
gcacgggtcttttcaattcttcggcaagaaagtgagagtgtgctgactctcaagggcctg
actcccacaggcacactccctctgggcgtcctctcaggaggcaagcagactatcgagaca
gccacagtagaagcggtagaggcccgggaagccatcagagggttctcgcttcagcacaag
atccggagttttgaagaagcgcgaggtctggaccgaattaatgagcgaatgccaccccga
aaggatagcatacacgctggtgggccaatgaaatctgtaacctcagcacactcacatgct
gcgcacaggagcgaccaagggaagaaagcccattcatga

KEGG   Homo sapiens (human): 5534Help
Entry
5534              CDS       T01001                                 

Gene name
PPP3R1, CALNB1, CNB, CNB1
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04720  Long-term potentiation
hsa04724  Glutamatergic synapse
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05031  Amphetamine addiction
hsa05152  Tuberculosis
hsa05163  Human cytomegalovirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00180  KSHV K1 to PLCG-calcineurin signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
Drug target
Ciclosporin: D00184
Pimecrolimus: D05480
Ruclosporin: D10983
Tacrolimus (DG00439): D00107 D08556
Voclosporin: D09033
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5534 (PPP3R1)
   04310 Wnt signaling pathway
    5534 (PPP3R1)
   04370 VEGF signaling pathway
    5534 (PPP3R1)
   04020 Calcium signaling pathway
    5534 (PPP3R1)
   04022 cGMP - PKG signaling pathway
    5534 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5534 (PPP3R1)
   04218 Cellular senescence
    5534 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    5534 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    5534 (PPP3R1)
   04660 T cell receptor signaling pathway
    5534 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    5534 (PPP3R1)
   04659 Th17 cell differentiation
    5534 (PPP3R1)
   04662 B cell receptor signaling pathway
    5534 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5534 (PPP3R1)
   04921 Oxytocin signaling pathway
    5534 (PPP3R1)
   04924 Renin secretion
    5534 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    5534 (PPP3R1)
   04720 Long-term potentiation
    5534 (PPP3R1)
  09158 Development
   04360 Axon guidance
    5534 (PPP3R1)
   04380 Osteoclast differentiation
    5534 (PPP3R1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    5534 (PPP3R1)
   05014 Amyotrophic lateral sclerosis (ALS)
    5534 (PPP3R1)
  09164 Substance dependence
   05031 Amphetamine addiction
    5534 (PPP3R1)
  09167 Infectious diseases
   05152 Tuberculosis
    5534 (PPP3R1)
   05166 HTLV-I infection
    5534 (PPP3R1)
   05163 Human cytomegalovirus infection
    5534 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5534 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    5534 (PPP3R1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     5534 (PPP3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 5534
NCBI-ProteinID: NP_000936
OMIM: 601302
HGNC: 9317
Ensembl: ENSG00000221823
Vega: OTTHUMG00000129561
Pharos: P63098(Tbio)
UniProt: P63098
Structure
PDB: 

Position
2p14
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgcggatgaaatt
aaaaggctaggaaagagatttaagaagcttgatttggacaattctggttctttgagtgtg
gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat
atattcgacacagatgggaatggagaagtagactttaaagaattcattgagggcgtctct
cagttcagtgtcaaaggagataaggagcagaaattgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtattgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

KEGG   Homo sapiens (human): 5535Help
Entry
5535              CDS       T01001                                 

Gene name
PPP3R2, PPP3RL
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, beta
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04720  Long-term potentiation
hsa04724  Glutamatergic synapse
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05031  Amphetamine addiction
hsa05152  Tuberculosis
hsa05163  Human cytomegalovirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00180  KSHV K1 to PLCG-calcineurin signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
Drug target
Ciclosporin: D00184
Pimecrolimus: D05480
Ruclosporin: D10983
Tacrolimus (DG00439): D00107 D08556
Voclosporin: D09033
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5535 (PPP3R2)
   04310 Wnt signaling pathway
    5535 (PPP3R2)
   04370 VEGF signaling pathway
    5535 (PPP3R2)
   04020 Calcium signaling pathway
    5535 (PPP3R2)
   04022 cGMP - PKG signaling pathway
    5535 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5535 (PPP3R2)
   04218 Cellular senescence
    5535 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    5535 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    5535 (PPP3R2)
   04660 T cell receptor signaling pathway
    5535 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    5535 (PPP3R2)
   04659 Th17 cell differentiation
    5535 (PPP3R2)
   04662 B cell receptor signaling pathway
    5535 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5535 (PPP3R2)
   04921 Oxytocin signaling pathway
    5535 (PPP3R2)
   04924 Renin secretion
    5535 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    5535 (PPP3R2)
   04720 Long-term potentiation
    5535 (PPP3R2)
  09158 Development
   04360 Axon guidance
    5535 (PPP3R2)
   04380 Osteoclast differentiation
    5535 (PPP3R2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    5535 (PPP3R2)
   05014 Amyotrophic lateral sclerosis (ALS)
    5535 (PPP3R2)
  09164 Substance dependence
   05031 Amphetamine addiction
    5535 (PPP3R2)
  09167 Infectious diseases
   05152 Tuberculosis
    5535 (PPP3R2)
   05166 HTLV-I infection
    5535 (PPP3R2)
   05163 Human cytomegalovirus infection
    5535 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5535 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    5535 (PPP3R2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     5535 (PPP3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_5 EF-hand_7 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Motif
Other DBs
NCBI-GeneID: 5535
NCBI-ProteinID: NP_671709
OMIM: 613821
HGNC: 9318
Ensembl: ENSG00000188386
Vega: OTTHUMG00000020386
Pharos: Q96LZ3(Tbio)
UniProt: Q96LZ3
Position
9q31.1
AA seq 173 aa AA seqDB search
MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRR
VIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLK
MMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaatgggaaacgaggccagttacccggcggagatgtgctcccactttgacaat
gatgaaattaaaaggctgggcaggaggtttaagaagttggacttggacaaatcagggtct
ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggcga
gtgatcgacgtcttcgacaccgacggtgatggagaagtggacttcaaggaattcatcctg
gggacctcccagttcagcgtcaagggcgacgaggagcagaagttgaggtttgcgttcagc
atttacgacatggataaagatggctacatttccaacggggagctcttccaggtgctgaag
atgatggtgggcaacaacctgacggactggcagctccagcagctggtcgacaaaaccatc
atcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc
agagacctggagatccacaagaagctggtcctcatcgtatga

DBGET integrated database retrieval system