KEGG   Homo sapiens (human): 55300Help
Entry
55300             CDS       T01001                                 

Gene name
PI4K2B, PI4KIIB, PIK42B
Definition
(RefSeq) phosphatidylinositol 4-kinase type 2 beta
  KO
K13711  phosphatidylinositol 4-kinase type 2 [EC:2.7.1.67]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    55300 (PI4K2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    55300 (PI4K2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55300 (PI4K2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.67  1-phosphatidylinositol 4-kinase
     55300 (PI4K2B)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    55300 (PI4K2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase
Motif
Other DBs
NCBI-GeneID: 55300
NCBI-ProteinID: NP_060793
OMIM: 612101
HGNC: 18215
Ensembl: ENSG00000038210 ENSG00000281028
Vega: OTTHUMG00000128564 OTTHUMG00000189521
Pharos: Q8TCG2(Tbio)
UniProt: Q8TCG2
Position
4p15.2
AA seq 481 aa AA seqDB search
MEDPSEPDRLASADGGSPEEEEDGEREPLLPRIAWAHPRRGAPGSAVRLLDAAGEEGEAG
DEELPLPPGDVGVSRSSSAELDRSRPAVSVTIGTSEMNAFLDDPEFADIMLRAEQAIEVG
IFPERISQGSSGSYFVKDPKRKIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCL
IPNQGYLSEAGAYLVDNKLHLSIVPKTKVVWLVSETFNYNAIDRAKSRGKKYALEKVPKV
GRKFHRIGLPPKIGSFQLFVEGYKEAEYWLRKFEADPLPENIRKQFQSQFERLVILDYII
RNTDRGNDNWLVRYEKQKCEKEIDHKESKWIDDEEFLIKIAAIDNGLAFPFKHPDEWRAY
PFHWAWLPQAKVPFSEEIRNLILPYISDMNFVQDLCEDLYELFKTDKGFDKATFESQMSV
MRGQILNLTQALRDGKSPFQLVQIPCVIVERSQGGSQGRIVHLSNSFTQTVNCRKPFFSS
W
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggaggatccctccgagcccgaccggttggcgtccgcggacggcgggagcccggaggag
gaggaggatggggagcgggagccgctgctaccgcggatcgcctgggcccacccgcggaga
ggcgccccaggcagcgccgtgaggctgctggacgctgccggggaggagggcgaggccggc
gacgaggagctgcccctcccgcccggggacgtgggggtctcccggagttcgtccgccgag
ctggaccggagccgccccgcggtttcagtaactattggtacttcagagatgaatgcattc
ttggatgacccagaatttgccgatattatgctgagagcagagcaagcaatagaagttgga
atttttccagaaagaatctctcaaggttcaagtggaagttactttgtgaaggatcctaag
aggaaaattattggtgtgtttaaacccaaatcagaagagccttatggtcaactcaatcca
aaatggaccaaatatgtccataaggtctgctgcccttgctgctttggccgaggctgcctg
attcctaatcaggggtacctttccgaagcgggtgcctatcttgtggacaacaagcttcat
ctgagcattgtacctaaaacaaaggtggtttggcttgtcagtgagacatttaactataat
gcgattgaccgtgcaaaatcaagaggcaaaaagtatgctttagaaaaagtgccaaaagtg
ggtagaaagtttcataggataggactccctcctaagattggttcctttcagttatttgtt
gaaggttacaaggaggctgaatattggcttaggaaatttgaagctgaccctttgcctgag
aatattagaaaacaatttcagtcacaatttgaaagattagttattttggattacatcatc
agaaatacagacaggggcaatgataattggttagtcagatacgaaaagcagaaatgtgaa
aaggaaattgaccataaggaatcaaaatggattgatgatgaagaattccttattaaaata
gctgcaattgataatggtctagcatttccttttaaacatcctgatgaatggagagcatat
ccatttcactgggcttggcttcctcaagcaaaagttcccttttctgaagaaataagaaat
ttgattctaccatatatttctgacatgaactttgtgcaagatttatgtgaagatctctat
gaactttttaagactgacaaaggatttgacaaagccacttttgaaagtcagatgtctgtg
atgaggggtcagatcttaaaccttactcaggcattgagagacgggaagagtcctttccag
ctagtacagataccttgtgtgattgtggaacgcagtcaaggtggaagtcagggtcggatt
gtccacctgagcaattcctttacccagactgtcaattgcaggaagccatttttttcctcc
tggtag

DBGET integrated database retrieval system