KEGG   Homo sapiens (human): 55301Help
Entry
55301             CDS       T01001                                 

Gene name
OLAH, AURA1, SAST, TE2, THEDC1
Definition
(RefSeq) oleoyl-ACP hydrolase
  KO
K01071  medium-chain acyl-[acyl-carrier-protein] hydrolase [EC:3.1.2.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    55301 (OLAH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    55301 (OLAH)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.21  dodecanoyl-[acyl-carrier-protein] hydrolase
     55301 (OLAH)
Lipid biosynthesis proteins [BR:hsa01004]
 Fatty acid synthase
  Component type
   55301 (OLAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioesterase Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Lipase_3 LIDHydrolase
Motif
Other DBs
NCBI-GeneID: 55301
NCBI-ProteinID: NP_001034791
HGNC: 25625
Ensembl: ENSG00000152463
Vega: OTTHUMG00000017724
Pharos: Q9NV23(Tdark)
UniProt: Q9NV23
Structure
PDB: 

Position
10p13
AA seq 265 aa AA seqDB search
MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRL
PGRESRVEEPLENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQP
EPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPII
RADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYL
LDPANEKLIKNYIIKCLEVSSISNF
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggagagaggagaccaacctaagagaaccaggaatgaaaacattttcaactgcttatac
aaaaaccctgaggcaacttttaagctgatttgctttccctggatgggaggtggctccact
cattttgccaaatggggccaagatactcatgatttgctggaagtgcactccttaaggctt
cctggaagagaaagcagagttgaagaacctcttgaaaatgacatctcccagttagttgat
gaagttgtttgtgctctgcagccagtcatccaggataaaccatttgcattttttggccac
agtatgggatcctacattgcttttaggactgcactaggtctaaaagaaaacaatcaacca
gaaccattgcatttatttttgtcaagtgcaactcctgtacattcaaaggcctggcatcgc
attcccaaagatgatgaattgtcagaagaacaaataagtcattaccttatggaatttgga
ggcacccccaagcattttgctgaagccaaggaatttgtgaaacaatgtagtcccatcata
agggcagatctgaacattgttagaagttgcacctctaacgtaccatctaaggctgttctt
tcctgtgacttgacatgttttgttggatctgaagacatagcaaaggacatggaagcctgg
aaagatgtaaccagtggaaatgctaaaatttaccagcttccagggggtcacttttatctt
ctggatcctgcgaacgagaaattaatcaagaactacataatcaagtgtctagaagtatca
tcgatatccaatttttag

DBGET integrated database retrieval system