KEGG   Homo sapiens (human): 55304Help
Entry
55304             CDS       T01001                                 

Gene name
SPTLC3, C20orf38, LCB_3, LCB2B, LCB3, SPT_3, SPT3, SPTLC2L, dJ718P11, dJ718P11.1, hLCB2b
Definition
(RefSeq) serine palmitoyltransferase long chain base subunit 3
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    55304 (SPTLC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    55304 (SPTLC3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    55304 (SPTLC3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     55304 (SPTLC3)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class II
   55304 (SPTLC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 55304
NCBI-ProteinID: NP_060797
OMIM: 611120
HGNC: 16253
Ensembl: ENSG00000172296
Vega: OTTHUMG00000031899
Pharos: Q9NUV7(Tbio)
UniProt: Q9NUV7
Position
20p12.1
AA seq 552 aa AA seqDB search
MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKLIVESFEEAPL
HVMVFTYMGYGIGTLFGYLRDFLRNWGIEKCNAAVERKEQKDFVPLYQDFENFYTRNLYM
RIRDNWNRPICSAPGPLFDLMERVSDDYNWTFRFTGRVIKDVINMGSYNFLGLAAKYDES
MRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVFGMGFATNSMNIPA
LVGKGCLILSDELNHTSLVLGARLSGATIRIFKHNNTQSLEKLLRDAVIYGQPRTRRAWK
KILILVEGVYSMEGSIVHLPQIIALKKKYKAYLYIDEAHSIGAVGPTGRGVTEFFGLDPH
EVDVLMGTFTKSFGASGGYIAGRKDLVDYLRVHSHSAVYASSMSPPIAEQIIRSLKLIMG
LDGTTQGLQRVQQLAKNTRYFRQRLQEMGFIIYGNENASVVPLLLYMPGKVAAFARHMLE
KKIGVVVVGFPATPLAEARARFCVSAAHTREMLDTVLEALDEMGDLLQLKYSRHKKSARP
ELYDETSFELED
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctaaccctggaggtggtgctgtttgcaacgggaaacttcacaatcacaagaaacag
agcaatggctcacaaagcagaaactgcacaaagaatggaatagtgaaggaagcccagcaa
aatgggaagccacatttttatgataagctcattgttgaatcgtttgaggaagcacccctt
catgttatggttttcacttacatgggatatggaattggaaccctgtttggctatctcaga
gactttttaagaaactggggaatagaaaaatgcaacgcagctgtggaacgaaaagaacaa
aaagattttgtgccactgtatcaagactttgaaaatttttatacaagaaacctttacatg
cgaatcagagacaactggaaccggcccatctgcagtgccccagggcctctgtttgatttg
atggagagggtatcagacgactataactggacgtttaggtttactggaagagtcatcaaa
gatgtcatcaacatgggctcctataacttccttggtcttgcagccaagtatgatgagtct
atgaggacaataaaggatgttttagaggtgtatggcacaggcgtggccagcaccaggcat
gaaatgggcaccttggataagcacaaggagttggaggaccttgtggctaagttcctgaat
gtggaagcagctatggtctttgggatgggattcgcaactaactcaatgaatatcccagca
ttagttggaaagggatgcctcattttaagtgatgagttaaaccacacatcgcttgtgctt
ggggcccgactctcaggtgcaaccataagaatcttcaaacacaacaacacacaaagccta
gagaagctcctgagagatgctgtcatctatggccagcctcgaacccgcagagcttggaaa
aagattctcatcctggtggagggtgtctacagcatggaaggttccatcgtgcatctgccc
cagatcatagctctaaagaagaaatacaaggcttacctctacatagatgaagctcacagt
attggggccgtgggcccaaccggccggggtgtcacggagttctttggactagaccctcat
gaagttgatgtgctcatgggcacattcaccaaaagttttggagcttcaggaggttacata
gctggaaggaaggacctcgtggattatttacgggttcactcgcatagtgctgtttatgct
tcatccatgagcccaccgatagcagagcaaatcatcagatcactaaaacttatcatggga
ctggatgggaccactcaagggctgcagagagtacagcaacttgcgaaaaacacaagatac
ttcagacaaagactgcaggaaatgggattcattatctatggcaatgagaatgcttctgtt
gttcctctgcttctttatatgcctggtaaagtagcggcttttgcaaggcatatgctagag
aaaaaaattggagtggtggtcgtgggatttccagccactcccctcgcagaagctcgggct
cggttttgtgtttcagcggcacatacccgggagatgttagacacggttttagaagctctt
gatgaaatgggtgatctcttgcaactgaaatattcccggcacaagaagtcagcacgtcct
gagctctatgatgagacgagctttgaactcgaagattaa

DBGET integrated database retrieval system