KEGG   Homo sapiens (human): 5531
Entry
5531              CDS       T01001                                 

Gene name
PPP4C, PP-X, PP4, PP4C, PPH3, PPP4, PPX
Definition
(RefSeq) protein phosphatase 4 catalytic subunit
  KO
K15423  serine/threonine-protein phosphatase 4 catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04922  Glucagon signaling pathway
Drug target
Fostriecin sodium: D04262
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5531 (PPP4C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5531 (PPP4C)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5531 (PPP4C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5531 (PPP4C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-4
    Catalytic subunits
     5531 (PPP4C)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Protein phosphatase 4
     5531 (PPP4C)
SSDB
Motif
Pfam: Metallophos STPPase_N Metallophos_2
Other DBs
NCBI-GeneID: 5531
NCBI-ProteinID: NP_001290432
OMIM: 602035
HGNC: 9319
Ensembl: ENSG00000149923
Vega: OTTHUMG00000132113
Pharos: P60510(Tbio)
UniProt: P60510 A0A024R625
Position
16p11.2
AA seq 307 aa
MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFY
DLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQI
TQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTI
DRKQEVPHDGPMCDLLWSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQL
VMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKK
PVADYFL
NT seq 924 nt   +upstreamnt  +downstreamnt
atggcggagatcagcgacctggaccggcagatcgagcagctgcgtcgctgcgagctcatc
aaggagagcgaagtcaaggccctgtgcgctaaggccagagagatcttggtagaggagagc
aacgtgcagagggtggactcgccagtcacagtgtgcggcgacatccatggacaattctat
gacctcaaagagctgttcagagtaggtggcgacgtccctgagaccaactacctcttcatg
ggggactttgtggaccgtggcttctatagcgtcgaaacgttcctcctgctgctggcactt
aaggttcgctatcctgatcgcatcacactgatccggggcaaccatgagagtcgccagatc
acgcaggtctatggcttctacgatgagtgcctgcgcaagtacggctcggtgactgtgtgg
cgctactgcactgagatctttgactacctcagcctgtcagccatcatcgatggcaagatc
ttctgcgtgcacgggggcctctccccctccatccagaccctggatcagattcggacaatc
gaccgaaagcaagaggtgcctcatgatgggcccatgtgtgacctcctctggtctgaccca
gaagacaccacaggctggggcgtgagcccccgaggagccggctacctatttggcagtgac
gtggtggcccagttcaacgcagccaatgacattgacatgatctgccgtgcccaccaactg
gtgatggaaggttacaagtggcacttcaatgagacggtgctcactgtgtggtcggcaccc
aactactgctaccgctgtgggaatgtggcagccatcttggagctggacgagcatctccag
aaagatttcatcatctttgaggctgctccccaagagacacggggcatcccctccaagaag
cccgtggccgactacttcctgtga

DBGET integrated database retrieval system