KEGG   Homo sapiens (human): 55313
Entry
55313             CDS       T01001                                 

Gene name
CPPED1, CSTP1
Definition
(RefSeq) calcineurin like phosphoesterase domain containing 1
  KO
K21814  serine/threonine-protein phosphatase CPPED1 [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    55313 (CPPED1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     55313 (CPPED1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     55313 (CPPED1)
SSDB
Motif
Pfam: Metallophos Metallophos_2 PGA_cap
Other DBs
NCBI-GeneID: 55313
NCBI-ProteinID: NP_060810
OMIM: 615603
HGNC: 25632
Ensembl: ENSG00000103381
Vega: OTTHUMG00000167711
Pharos: Q9BRF8(Tdark)
UniProt: Q9BRF8
Position
16p13.12
AA seq 314 aa
MSAAEAGGVFHRARGRTLAAFPAEKESEWKGPFYFILGADPQFGLIKAWSTGDCDNGGDE
WEQEIRLTEQAVQAINKLNPKPKFFVLCGDLIHAMPGKPWRTEQTEDLKRVLRAVDRAIP
LVLVSGNHDIGNTPTAETVEEFCRTWGDDYFSFWVGGVLFLVLNSQFYENPSKCPSLKQA
QDQWLDEQLSIARQRHCQHAIVFQHIPLFLESIDEDDDYYFNLSKSTRKKLADKFIHAGV
KVVFSGHYHRNAGGTYQNLDMVVSSAIGCQLGRDPHGLRVVVVTAEKIVHRYYSLDELSE
KGIEDDLMDLIKKK
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtcggctgcagaggcggggggtgttttccacagagccaggggcaggaccctggccgcg
tttcccgcagaaaaggaaagcgaatggaaaggcccattctacttcatcctgggcgcagac
ccacagtttgggctgatcaaggcctggtccactggggactgtgacaatggcggtgacgaa
tgggaacaggagatccgtctaactgagcaagccgtccaggccatcaacaagctgaacccc
aaacccaaattcttcgttctgtgcggcgacctcatccacgccatgccagggaagccgtgg
cggacggagcagacggaggacctgaagcgagtgcttagggcagtggacagggccatccca
ctggtccttgtcagcggcaaccatgacattggcaacacccccacggccgagaccgtcgag
gagttctgccggacttggggagatgactacttcagcttctgggtcgggggcgtcctgttc
ctggtcctcaactcccagttctacgagaacccctccaaatgccccagcctgaagcaggct
caggaccagtggctggacgagcagctgagcatcgcgaggcagcggcactgccagcatgcc
atcgtcttccagcacatcccgctgttcctggagagcatcgacgaggacgacgactactac
ttcaacctcagcaagtccactcggaagaagttggcagacaagttcatccacgcaggtgtc
aaagtcgtgttctcaggccactaccacaggaatgccgggggtacctaccagaacctcgac
atggtggtgtcatctgccattggatgccagctgggcagagacccccacgggctccgagtc
gtggtggtcaccgccgagaaaattgttcaccgatactacagtctagatgagctgagtgag
aaaggaatagaagacgatctcatggatttgatcaagaaaaaatga

DBGET integrated database retrieval system