KEGG   Homo sapiens (human): 55315Help
Entry
55315             CDS       T01001                                 

Gene name
SLC29A3, ENT3, HCLAP, HJCD, PHID
Definition
(RefSeq) solute carrier family 29 member 3
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
hsa  Homo sapiens (human)
Disease
H00815  H syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55315 (SLC29A3)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC29: Facilitative nucleoside transporter
   55315 (SLC29A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran
Motif
Other DBs
NCBI-GeneID: 55315
NCBI-ProteinID: NP_060814
OMIM: 612373
HGNC: 23096
Ensembl: ENSG00000198246
Vega: OTTHUMG00000018424
Pharos: Q9BZD2(Tbio)
UniProt: Q9BZD2
Position
10q22.1
AA seq 475 aa AA seqDB search
MAVVSEDDFQHSSNSTYRTTSSSLRADQEALLEKLLDRPPPGLQRPEDRFCGTYIIFFSL
GIGSLLPWNFFITAKEYWMFKLRNSSSPATGEDPEGSDILNYFESYLAVASTVPSMLCLV
ANFLLVNRVAVHIRVLASLTVILAIFMVITALVKVDTSSWTRGFFAVTIVCMVILSGAST
VFSSSIYGMTGSFPMRNSQALISGGAMGGTVSAVASLVDLAASSDVRNSALAFFLTATVF
LVLCMGLYLLLSRLEYARYYMRPVLAAHVFSGEEELPQDSLSAPSVASRFIDSHTPPLRP
ILKKTASLGFCVTYVFFITSLIYPAICTNIESLNKGSGSLWTTKFFIPLTTFLLYNFADL
CGRQLTAWIQVPGPNSKALPGFVLLRTCLIPLFVLCNYQPRVHLKTVVFQSDVYPALLSS
LLGLSNGYLSTLALLYGPKIVPRELAEATGVVMSFYVCLGLTLGSACSTLLVHLI
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgtctcagaggacgactttcagcacagttcaaactccacctacagaaccaca
agcagcagtctccgagctgaccaggaggcactgcttgagaagctgctggaccgcccgccc
cctggcctgcagaggcccgaggaccgcttctgtggcacatacatcatcttcttcagcctg
ggcattggcagtctactgccatggaacttctttatcactgccaaggagtactggatgttc
aaactccgcaactcctccagcccagccaccggggaggaccctgagggctcagacatcctg
aactactttgagagctaccttgccgttgcctccaccgtgccctccatgctgtgcctggtg
gccaacttcctgcttgtcaacagggttgcagtccacatccgtgtcctggcctcactgacg
gtcatcctggccatcttcatggtgataactgcactggtgaaggtggacacttcctcctgg
acccgtggcttttttgcggtcaccattgtctgcatggtgatcctcagcggtgcctccact
gtcttcagcagcagcatctacggcatgaccggctcctttcctatgaggaactcccaggca
ctgatatcaggaggagccatgggcgggacggtcagcgccgtggcctcattggtggacttg
gctgcatccagtgatgtgaggaacagcgccctggccttcttcctgacggccactgtcttc
ctcgtgctctgcatgggactctacctgctgctgtccaggctggagtatgccaggtactac
atgaggcctgttcttgcggcccatgtgttttctggtgaagaggagcttccccaggactcc
ctcagtgccccttcggtggcctccagattcattgattcccacacaccccctctccgcccc
atcctgaagaagacggccagcctgggcttctgtgtcacctacgtcttcttcatcaccagc
ctcatctaccccgccatctgcaccaacatcgagtccctcaacaagggttcgggctcactg
tggaccaccaagtttttcatccccctcactaccttcctcctgtacaactttgctgaccta
tgtggccggcagctcaccgcctggatccaggtgccagggcccaatagcaaggcgctccca
gggttcgtgctcctccggacctgcctcatccccctcttcgtgctctgtaactaccagccc
cgcgtccacctgaagactgtggtcttccagtccgatgtgtaccccgcactcctcagctcc
ctgctggggctcagcaacggctacctcagcaccctggccctcctctacgggcctaagatt
gtgcccagggagctggctgaggccacgggagtggtgatgtccttttatgtgtgcttgggc
ttaacactgggctcagcctgctctaccctcctggtgcacctcatctag

DBGET integrated database retrieval system