KEGG   Homo sapiens (human): 5532Help
Entry
5532              CDS       T01001                                 

Gene name
PPP3CB, CALNA2, CALNB, CNA2, PP2Bbeta
Definition
(RefSeq) protein phosphatase 3 catalytic subunit beta
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04720  Long-term potentiation
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05031  Amphetamine addiction
hsa05152  Tuberculosis
hsa05163  Human cytomegalovirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00180  KSHV K1 to PLCG-calcineurin signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
Drug target
Ciclosporin: D00184
Pimecrolimus: D05480
Ruclosporin: D10983
Tacrolimus (DG00439): D00107 D08556
Voclosporin: D09033
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5532 (PPP3CB)
   04310 Wnt signaling pathway
    5532 (PPP3CB)
   04370 VEGF signaling pathway
    5532 (PPP3CB)
   04020 Calcium signaling pathway
    5532 (PPP3CB)
   04022 cGMP - PKG signaling pathway
    5532 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5532 (PPP3CB)
   04218 Cellular senescence
    5532 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    5532 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    5532 (PPP3CB)
   04660 T cell receptor signaling pathway
    5532 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    5532 (PPP3CB)
   04659 Th17 cell differentiation
    5532 (PPP3CB)
   04662 B cell receptor signaling pathway
    5532 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5532 (PPP3CB)
   04921 Oxytocin signaling pathway
    5532 (PPP3CB)
   04924 Renin secretion
    5532 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    5532 (PPP3CB)
   04728 Dopaminergic synapse
    5532 (PPP3CB)
   04720 Long-term potentiation
    5532 (PPP3CB)
  09158 Development
   04360 Axon guidance
    5532 (PPP3CB)
   04380 Osteoclast differentiation
    5532 (PPP3CB)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    5532 (PPP3CB)
   05014 Amyotrophic lateral sclerosis (ALS)
    5532 (PPP3CB)
  09164 Substance dependence
   05031 Amphetamine addiction
    5532 (PPP3CB)
  09167 Infectious diseases
   05152 Tuberculosis
    5532 (PPP3CB)
   05166 HTLV-I infection
    5532 (PPP3CB)
   05163 Human cytomegalovirus infection
    5532 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5532 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    5532 (PPP3CB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5532 (PPP3CB)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     5532 (PPP3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos DUF5378
Motif
Other DBs
NCBI-GeneID: 5532
NCBI-ProteinID: NP_066955
OMIM: 114106
HGNC: 9315
Ensembl: ENSG00000107758
Vega: OTTHUMG00000018472
Pharos: P16298(Tbio)
UniProt: P16298
Structure
PDB: 

Position
10q22.2
AA seq 524 aa AA seqDB search
MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFS
VLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFE
EAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggccgccccggagccggcccgggctgcaccgcccccacccccgcccccgccgccccct
cccggggctgaccgcgtcgtcaaagctgtccctttccccccaacacatcgcttgacatct
gaagaagtatttgatttggatgggatacccagggttgatgttctgaagaaccacttggtg
aaagaaggtcgagtagatgaagaaattgcgcttagaattatcaatgagggtgctgccatc
cttcggagagagaaaaccatgatagaagtagaagctccaatcacagtgtgtggtgacatc
catggccaattttttgatctgatgaaactttttgaagtaggaggatcacctgctaataca
cgatacctttttcttggcgattatgtggacagaggttattttagtatagagtgtgtctta
tatttatgggttctgaagattctatacccaagcacattatttcttctgagaggcaaccat
gaatgcagacaccttactgaatattttacctttaagcaggaatgtaaaattaagtattcg
gaaagagtctatgaagcttgtatggaagcttttgatagtttgcctcttgctgcactttta
aaccaacagtttctttgtgttcatggtggactttcaccagaaatacacacactggatgat
attaggagattagatagattcaaagagccacctgcatttggaccaatgtgtgacttgtta
tggtccgatccttctgaagattttggaaatgaaaaatcacaggaacattttagtcacaat
acagttcgaggatgttcttatttttataactatccagcagtgtgtgaatttttgcaaaac
aataatttgttatcgattattagagctcatgaagctcaagatgcaggctatagaatgtac
agaaaaagtcaaactacagggttcccttcattaataacaattttttcggcacctaattac
ttagatgtctacaataataaagctgctgtattaaagtatgaaaataatgtgatgaatatt
cgacagtttaactgttctccacatccttactggttgcctaattttatggatgtcttcacg
tggtctttaccgtttgttggagaaaaagtgacagaaatgttggtaaatgttctgagtatt
tgctctgatgatgaactaatgactgaaggtgaagaccagtttgatggttcagctgcagcc
cggaaagaaatcataagaaacaaaattcgagcaattggcaagatggcaagagtcttctct
gttctcagggaggagagtgaaagtgtgctgacactcaagggcctgactcccacagggatg
ttgcctagtggagtgttagctggaggacggcagaccctgcaaagtgccacagttgaggct
attgaggctgaaaaagcaatacgaggattctctccaccacatagaatctgcagttttgaa
gaggcaaagggtttggataggatcaatgagagaatgccacctcggaaagatgctgtacag
caagatggtttcaattctctgaacaccgcacatgccactgagaaccacgggacgggcaac
catactgcccagtga

DBGET integrated database retrieval system