KEGG   Homo sapiens (human): 55320
Entry
55320             CDS       T01001                                 

Gene name
MIS18BP1, C14orf106, HSA242977, KNL2, M18BP1
Definition
(RefSeq) MIS18 binding protein 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SANTA Myb_DNA-binding Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 55320
NCBI-ProteinID: NP_060823
OMIM: 618139
HGNC: 20190
Ensembl: ENSG00000129534
Vega: OTTHUMG00000140266
Pharos: Q6P0N0(Tdark)
UniProt: Q6P0N0
Structure
PDB: 
1WGX

Position
14q21.2
AA seq 1132 aa
MIATPLKHSRIYLPPEASSQRRNLPMDAIFFDSIPSGTLTPVKDLVKYQNSSLKLNDHKK
NQFLKMTTFNNKNIFQSTMLTEATTSNSSLDISAIKPNKDGLKNKANYESPGKIFLRMKE
KVLRDKQEQPSRNSSLLEPQKSGNNETFTPNRVEKKKLQHTYLCEEKENNKSFQSDDSSL
RASVQGVPLESSNNDIFLPVKQKIQCQQEKKAPLHNLTYELPTLNQEQENFLAVEARNKT
LTRAQLAKQIFHSKESIVATTKSKKDTFVLESVDSADEQFQNTNAETLSTNCIPIKNGSL
LMVSDSERTTEGTSQQKVKEGNGKTVPGETGLPGSMKDTCKIVLATPRLHITIPRRSKRN
ISKLSPPRIFQTVTNGLKKNQVVQLQEWMIKSINNNTAICVEGKLIDVTNIYWHSNVIIE
RIEHNKLRTISGNVYILKGMIDQISMKEAGYPNYLIRKFMFGFPENWKEHIDNFLEQLRA
GEKNREKTKQKQKTGRSVRDIRKSMKNDARENQTDTAQRATTTYDFDCDNLELKSNKHSE
SPGATELNMCHSNCQNKPTLRFPDDQVNNTIQNGGGDDLSNQELIGKKEYKMSSKKLKIG
ERTNERIIKSQKQETTEELDVSIDILTSREQFFSDEERKYMAINQKKAYILVTPLKSRKV
IEQRCMRYNLSAGTIKAVTDFVIPECQKKSPISKSMGTLENTFEGHKSKNKEDCDERDLL
TVNRKIKISNLEKEQMLTSDFKKNTRLLPKLKKIENQVAMSFYKHQSSPDLSSEESETEK
EIKRKAEVKKTKAGNTKEAVVHLRKSTRNTSNIPVILEPETEESENEFYIKQKKARPSVK
ETLQKSGVRKEFPITEAVGSDKTNRHPLECLPGLIQDKEWNEKELQKLHCAFASLPKHKP
GFWSEVAAAVGSRSPEECQRKYMENPRGKGSQKHVTKKKPANSKGQNGKRGDADQKQTIK
ITAKVGTLKRKQQMREFLEQLPKDDHDDFFSTTPLQHQRILLPSFQDSEDDDDILPNMDK
NPTTPSSVIFPLVKTPQCQHVSPGMLGSINRNDCDKYVFRMQKYHKSNGGIVWGNIKKKL
VETDFSTPTPRRKTPFNTDLGENSGIGKLFTNAVESLDEEEKDYYFSNSDSA
NT seq 3399 nt   +upstreamnt  +downstreamnt
atgattgcaacacctttgaaacattcaagaatttacttacctccagaggcatcttctcaa
aggagaaatctacccatggatgcaatcttttttgacagcattccttcaggcacacttact
cctgtaaaagatttggtgaaatatcagaactcctccttaaaattgaatgaccataaaaag
aatcagttcctaaaaatgacaacttttaacaataaaaatatatttcaatcaactatgcta
acagaggctactacctctaacagttctcttgatatcagtgctataaagcccaacaaggat
ggattaaaaaataaagcaaactatgaatcaccaggaaaaatatttctaagaatgaaagaa
aaagtactgcgtgacaagcaagaacagccatcaagaaacagtagtttgttggaaccacag
aaaagtggaaataatgaaaccttcactcctaacagagttgaaaaaaaaaaattgcagcat
acctacctatgtgaagaaaaggaaaacaacaaatcattccagtcagatgacagttcacta
agagcctcagtccaaggagttcctctagaatcatcaaataatgatattttcctcccggtc
aaacaaaagattcagtgccagcaggaaaagaaagcaccactgcacaatttaacttacgaa
cttccaactctgaaccaagaacaggaaaattttttggctgtagaagcccgaaacaagaca
ttaactagagctcagttggctaaacaaatttttcactcaaaggagagtatagttgcaacc
actaaatccaaaaaggacacgtttgttttagaaagcgttgattctgctgatgaacaattt
caaaatactaatgctgagactctcagtactaattgtattcctattaaaaatggcagcctg
ttaatggtttctgatagtgagaggacaacagaagggacttcgcaacagaaagttaaggaa
ggaaatggaaaaacagtgcctggagagacaggtcttccaggttccatgaaagatacatgt
aaaattgtacttgcaacaccaagacttcatataacaatacctcggaggtcaaaaagaaat
atttcaaagctttctcctccaagaatatttcaaactgttacaaatggacttaaaaaaaat
caggtagttcagctacaggaatggatgattaaaagcatcaataataatactgctatatgt
gtagaaggaaaattgatagacgtcactaacatatattggcacagtaatgtaattatagag
cggattgagcacaacaaacttaggactatatcaggcaacgtttatatattaaaaggcatg
atagaccaaatttccatgaaagaagcaggatatccaaattatctcataaggaaatttatg
tttggatttccagaaaattggaaagagcacattgataattttctggaacaattaagggct
ggtgaaaagaacagggaaaagaccaaacaaaaacagaaaactggaagatctgtccgtgac
ataaggaaatcaatgaaaaatgatgcacgagaaaaccaaacagatactgctcaaagagcc
accaccacttacgattttgattgtgataatttggaactgaagagtaataagcacagtgag
tcaccaggagctacagaattaaacatgtgccacagtaattgccaaaataaaccaacatta
aggttcccagatgaccaagtaaataatactattcaaaatggaggaggagatgacttatct
aatcaggaattaattggaaaaaaagaatataaaatgtcttcaaagaaactaaaaattggt
gaaagaacaaatgaaaggataataaaaagtcagaagcaagagacaactgaagaattggat
gtatccattgatattctaacctcaagggaacagtttttctcagatgaagaaagaaaatac
atggccatcaatcagaagaaagcttatattttagtaacaccacttaaatctagaaaagtg
atagagcaaagatgcatgaggtataatctgtccgctggcaccatcaaagcagtaacagat
tttgtaataccagagtgtcaaaaaaaaagtcccatcagcaagtccatggggactttagaa
aatacatttgaaggtcataaaagtaaaaacaaggaagattgcgatgaacgtgacttactt
actgtcaaccggaaaataaaaatatctaaccttgaaaaggaacaaatgctcacctctgac
tttaagaaaaataccagactattaccaaaattgaagaaaatagaaaatcaggtagctatg
tcattttataagcatcagtcctcaccagatttgtcaagtgaagaaagtgaaacagaaaag
gaaattaaaaggaaagctgaagttaagaaaaccaaagcaggaaacaccaaagaagcagtg
gttcacctgagaaagagcacaagaaacacaagtaatattccagtgattttggaacctgaa
actgaagaaagtgaaaatgaattttatatcaaacaaaagaaagctagaccttccgtcaaa
gaaactcttcagaagtctggtgttaggaaagagtttccaattactgaggcagtaggatct
gataagacaaataggcatcccttagaatgcttacctggtttaattcaggataaggaatgg
aatgagaaggagttacagaaacttcattgtgcttttgcatctcttccaaagcacaaacct
ggtttctggtcagaggtagctgcggctgtaggttctcgatctcctgaagaatgccagagg
aaatacatggaaaatcccagaggaaaaggatcccagaaacatgtcactaagaagaagcca
gccaattccaaaggccaaaatggcaagagaggtgatgctgatcagaaacaaactattaag
ataactgccaaagtgggaactcttaaaaggaagcaacagatgagggaatttctggaacag
ttgccaaaagatgaccatgatgattttttcagtacaacacctttacagcatcaaagaata
ctgttgccaagtttccaggacagtgaagatgatgatgatattctgccaaatatggacaaa
aatccaacaactccatcatcagttatctttccattggtaaaaactcctcaatgtcagcat
gtcagtcctggcatgctaggttctataaataggaatgactgtgataaatatgtttttcgt
atgcaaaaatatcataaaagtaatggtggtattgtctggggcaacatcaagaaaaaatta
gttgaaactgatttctcaactccaacaccaagaaggaaaaccccatttaacacagactta
ggagaaaactctggtattggaaaacttttcactaatgctgtggaatctttagatgaagaa
gagaaagattattatttttcgaactctgattctgcatag

DBGET integrated database retrieval system