KEGG   Homo sapiens (human): 55321Help
Entry
55321             CDS       T01001                                 

Gene name
TMEM74B, C20orf46
Definition
(RefSeq) transmembrane protein 74B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Neurensin
Motif
Other DBs
NCBI-GeneID: 55321
NCBI-ProteinID: NP_001291677
HGNC: 15893
Ensembl: ENSG00000125895
Vega: OTTHUMG00000031655
Pharos: Q9NUR3(Tdark)
UniProt: Q9NUR3
Position
20p13
AA seq 256 aa AA seqDB search
MPPAQGYEFAAAKGPRDELGPSFPMASPPGLELKTLSNGPQAPRRSAPLGPVAPTREGVE
NACFSSEEHETHFQNPGNTRLGSSPSPPGGVSSLPRSQRDDLSLHSEEGPALEPVSRPVD
YGFVSALVFLVSGILLVVTAYAIPREARVNPDTVTAREMERLEMYYARLGSHLDRCIIAG
LGLLTVGGMLLSVLLMVSLCKGELYRRRTFVPGKGSRKTYGSINLRMRQLNGDGGQALVE
NEVVQVSETSHTLQRS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgccaccagcacaggggtatgagtttgcagctgccaaggggccaagggatgagctgggg
ccctccttcccaatggcatctccccctggtctggaactgaagacactgagcaatggtccc
caagccccaaggagatcagctcccctgggcccagtggccccaaccagggagggtgtggag
aatgcctgcttctcctcagaggagcatgagacccatttccagaaccctgggaacacgaga
ctgggcagctcacccagtccccctgggggtgtctcctcactgccccgatcccagcgggat
gatctgtcccttcattcagaggaggggccagccctggagcccgtgagccgcccggtggat
tatggctttgtttccgccctcgttttcctggtgagtgggattcttctggtggtgacagca
tacgccatcccccgtgaggctcgagtcaatccggacacagtgacagcgcgggagatggaa
cgactggagatgtactacgcccgcctaggctcccacctggacaggtgcatcatcgcaggc
ctcgggctgctcacggtgggcggcatgctcttgtcggtgctgctcatggtctccctgtgc
aagggcgagctgtaccgccggaggaccttcgtccccggcaagggctccaggaagacctac
ggctccattaacctgcgcatgagacagctcaatggggatgggggccaggccctggtggag
aatgaagttgtccaggtctcagagactagccacaccctccagaggtcttaa

DBGET integrated database retrieval system