KEGG   Homo sapiens (human): 55327Help
Entry
55327             CDS       T01001                                 

Gene name
LIN7C, LIN-7-C, LIN-7C, MALS-3, MALS3, VELI3
Definition
(RefSeq) lin-7 homolog C, crumbs cell polarity complex component
  KO
K19931  protein lin-7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55327 (LIN7C)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    55327 (LIN7C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: L27 PDZ PDZ_6 PDZ_2 Complex1_LYR_2 His_Phos_2
Motif
Other DBs
NCBI-GeneID: 55327
NCBI-ProteinID: NP_060832
OMIM: 612332
HGNC: 17789
Ensembl: ENSG00000148943
Vega: OTTHUMG00000166193
Pharos: Q9NUP9(Tbio)
UniProt: Q9NUP9
Position
11p14.1
AA seq 197 aa AA seqDB search
MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYET
VDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYIS
RIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEE
MESRFEKMRSAKRRQQT
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctaggggaacccgtgcggctggagagagatatttgtagagcaattgaatta
ttggaaaaactacaaaggagtggagaagtaccaccacagaaacttcaggctttgcaaaga
gtccttcaaagtgaattctgcaatgctgtgagagaggtatatgaacatgtctatgagact
gtggacatcagtagcagtcctgaagtgagagcgaacgctactgcaaaggctactgttgct
gcatttgctgccagtgaaggacattctcatcctcgagttgttgagctaccaaaaacagaa
gagggccttggattcaatattatgggaggcaaagaacaaaactctccaatctatatatcc
cgaataattccaggtggaattgctgatagacatgggggcctcaaacgtggagatcaactc
ctctctgttaatggagtgagtgttgaaggagaacatcatgaaaaagctgtagaactgctg
aaagccgcacaaggaaaggttaaattagtggtacgatacacacccaaagtcttagaagaa
atggagtcgcgctttgaaaaaatgagatcagcaaaacgcaggcaacagacctaa

DBGET integrated database retrieval system