KEGG   Homo sapiens (human): 55328
Entry
55328             CDS       T01001                                 

Gene name
RNLS, C10orf59, RENALASE
Definition
(RefSeq) renalase, FAD dependent amine oxidase
  KO
K18208  renalase [EC:1.6.3.5]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    55328 (RNLS)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.5  renalase
     55328 (RNLS)
SSDB
Motif
Pfam: NAD_binding_8 Amino_oxidase NAD_binding_9 DAO Pyr_redox_2 Pyr_redox FAD_binding_3 Trp_halogenase
Other DBs
NCBI-GeneID: 55328
NCBI-ProteinID: NP_001026879
OMIM: 609360
HGNC: 25641
Ensembl: ENSG00000184719
Vega: OTTHUMG00000018692
Pharos: Q5VYX0(Tbio)
UniProt: Q5VYX0
Structure
PDB: 
3QJ4

Position
10q23.31
AA seq 342 aa
MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGA
QYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLK
ESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISEC
QRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGP
SLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANC
PGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggcgcaggtgctgatcgtgggcgccgggatgacaggaagcttgtgcgctgcgctgctg
aggaggcagacgtccggtcccttgtaccttgctgtgtgggacaaggctgaggactcaggg
ggaagaatgactacagcctgcagtcctcataatcctcagtgcacagctgacttgggtgct
cagtacatcacctgcactcctcattatgccaaaaaacaccaacgtttttatgatgaactg
ttagcctatggcgttttgaggcctctaagctcgcctattgaaggaatggtgatgaaagaa
ggagactgtaactttgtggcacctcaaggaatttcttcaattattaagcattacttgaaa
gaatcaggtgcagaagtctacttcagacatcgtgtgacacagatcaacctaagagatgac
aaatgggaagtatccaaacaaacaggctcccctgagcagtttgatcttattgttctcaca
atgccagttcctgagattctgcagcttcaaggtgacatcaccaccttaattagtgaatgc
caaaggcagcaactggaggctgtgagctactcctctcgatatgctctgggcctcttttat
gaagctggtacgaagattgatgtcccttgggctgggcagtacatcaccagtaatccctgc
atacgcttcgtctccattgataataagaagcgcaatatagagtcatcagaaattgggcct
tccctcgtgattcacaccactgtcccatttggagttacatacttggaacacagcattgag
gatgtgcaagagttagtcttccagcagctggaaaacattttgccgggtttgcctcagcca
attgctaccaaatgccaaaaatggagacattcacaggttacaaatgctgctgccaactgt
cctggccaaatgactctgcatcacaaacctttccttgcatgtggaggggatggatttact
cagtccaactttgatggctgcatcacttctgccctatgtgttctggaagctttaaagaat
tatatttag

DBGET integrated database retrieval system