KEGG   Homo sapiens (human): 5533Help
Entry
5533              CDS       T01001                                 

Gene name
PPP3CC, CALNA3, CNA3, PP2Bgamma
Definition
(RefSeq) protein phosphatase 3 catalytic subunit gamma
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04720  Long-term potentiation
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa05010  Alzheimer's disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05031  Amphetamine addiction
hsa05152  Tuberculosis
hsa05163  Human cytomegalovirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
Network
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00180  KSHV K1 to PLCG-calcineurin signaling pathway
Drug target
Ciclosporin: D00184
Pimecrolimus: D05480
Ruclosporin: D10983
Tacrolimus (DG00439): D00107 D08556
Voclosporin: D09033
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5533 (PPP3CC)
   04310 Wnt signaling pathway
    5533 (PPP3CC)
   04370 VEGF signaling pathway
    5533 (PPP3CC)
   04020 Calcium signaling pathway
    5533 (PPP3CC)
   04022 cGMP - PKG signaling pathway
    5533 (PPP3CC)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    5533 (PPP3CC)
   04218 Cellular senescence
    5533 (PPP3CC)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    5533 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    5533 (PPP3CC)
   04660 T cell receptor signaling pathway
    5533 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    5533 (PPP3CC)
   04659 Th17 cell differentiation
    5533 (PPP3CC)
   04662 B cell receptor signaling pathway
    5533 (PPP3CC)
  Endocrine system
   04922 Glucagon signaling pathway
    5533 (PPP3CC)
   04921 Oxytocin signaling pathway
    5533 (PPP3CC)
   04924 Renin secretion
    5533 (PPP3CC)
  Nervous system
   04724 Glutamatergic synapse
    5533 (PPP3CC)
   04728 Dopaminergic synapse
    5533 (PPP3CC)
   04720 Long-term potentiation
    5533 (PPP3CC)
  Development
   04360 Axon guidance
    5533 (PPP3CC)
   04380 Osteoclast differentiation
    5533 (PPP3CC)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    5533 (PPP3CC)
   05014 Amyotrophic lateral sclerosis (ALS)
    5533 (PPP3CC)
  Substance dependence
   05031 Amphetamine addiction
    5533 (PPP3CC)
  Infectious diseases
   05152 Tuberculosis
    5533 (PPP3CC)
   05166 HTLV-I infection
    5533 (PPP3CC)
   05163 Human cytomegalovirus infection
    5533 (PPP3CC)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    5533 (PPP3CC)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5533 (PPP3CC)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     5533 (PPP3CC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Motif
Other DBs
NCBI-GeneID: 5533
NCBI-ProteinID: NP_005596
OMIM: 114107
HGNC: 9316
Ensembl: ENSG00000120910
Vega: OTTHUMG00000163802
Pharos: P48454(Tbio)
UniProt: P48454
Position
8p21.3
AA seq 512 aa AA seqDB search
MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTDYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNVLNICSDDELISDDEAEGSTTVRKEIIRNKIRAIGKMARVFSILRQESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHKIRSFEEARGLDRINERMPPR
KDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggaggcgcttccacctctccaccaccgaccgcgtcatcaaagctgtccccttt
cctccaacccaacggcttactttcaaggaagtatttgagaatgggaaacctaaagttgat
gttttaaaaaaccatttggtaaaggaaggacgactggaagaggaagtagccttaaagata
atcaatgatggggctgccatcctgaggcaagagaagactatgatagaagtagatgctcca
atcacagtatgtggtgatattcatggacaattctttgacctaatgaagttatttgaagtt
ggaggatcacctagtaacacacgctacctctttctgggtgactatgtggacagaggctat
ttcagtatagagtgtgtgctgtatttatggagtttaaagattaatcatcccaaaacattg
tttctgcttcggggaaatcatgaatgcaggcatcttacagactatttcaccttcaaacag
gaatgtcgaatcaaatattcggaacaggtgtatgatgcctgtatggagacatttgactgt
cttcctcttgctgccctcttaaaccagcagtttctctgtgtacatggaggaatgtcacct
gaaattacttctttagatgacattaggaaattagacaggtttacggaacctcccgccttt
ggacctgtgtgtgacctgctttggtctgatccctcagaggattatggcaatgagaagacc
ttggagcactatacccacaacactgtccgagggtgctcttatttctacagttaccctgca
gtttgtgaatttttgcagaacaataatttactatcaattatcagagcccatgaagcccaa
gatgctgggtatcgaatgtacaggaagagccaagccacaggctttccatcacttattaca
attttctctgcccccaattacctagatgtctataacaataaagctgctgtgttgaaatat
gaaaacaatgtcatgaatatcaggcagtttaactgttctccacacccctactggcttcca
aactttatggatgttttcacatggtctttgccttttgttggggaaaaagtcacagagatg
ctggtaaatgtgctcaacatatgctctgatgacgaactgatttctgatgatgaagcagaa
ggaagcactacagttcgtaaggagatcatcaggaataagatcagagccattgggaagatg
gcacgggtcttttcaattcttcggcaagaaagtgagagtgtgctgactctcaagggcctg
actcccacaggcacactccctctgggcgtcctctcaggaggcaagcagactatcgagaca
gccacagtagaagcggtagaggcccgggaagccatcagagggttctcgcttcagcacaag
atccggagttttgaagaagcgcgaggtctggaccgaattaatgagcgaatgccaccccga
aaggatagcatacacgctggtgggccaatgaaatctgtaacctcagcacactcacatgct
gcgcacaggagcgaccaagggaagaaagcccattcatga

DBGET integrated database retrieval system