KEGG   Homo sapiens (human): 55337Help
Entry
55337             CDS       T01001                                 

Gene name
SHFL, C19orf66, IRAV, RyDEN, SFL
Definition
(RefSeq) shiftless antiviral inhibitor of ribosomal frameshifting
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0515 zf-3CxxC_2 zinc_ribbon_4 Zn-ribbon_8
Motif
Other DBs
NCBI-GeneID: 55337
NCBI-ProteinID: NP_060851
OMIM: 616808
HGNC: 25649
Ensembl: ENSG00000130813
Vega: OTTHUMG00000180393
Pharos: Q9NUL5(Tdark)
UniProt: Q9NUL5
Position
19p13.2
AA seq 291 aa AA seqDB search
MSQEGVELEKSVRRLREKFHGKVSSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSN
DLDAQDPPEDMKQDRDIQAVATSLLPLTEANLRMFQRAQDDLIPAVDRQFACSSCDHVWW
RRVPQRKEVSRCRKCRKRYEPVPADKMWGLAEFHCPKCRHNFRGWAQMGSPSPCYGCGFP
VYPTRILPPRWDRDPDRRSTHTHSCSAADCYNRREPHVPGTSCAHPKSRKQNHLPKVLHP
SNPHISSGSTVATCLSQGGLLEDLDNLILEDLKEEEEEEEEVEDEEGGPRE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggaaggtgtggagctggagaagagcgtccggcgcctccgggagaagtttcat
gggaaggtatcctccaagaaggcgggggctctgatgaggaaattcggcagcgaccacacg
ggagtggggcgctccatcgtgtacggggtaaagcaaaaagatggccaagaactaagtaac
gatctggatgcccaggatccaccagaagatatgaagcaggaccgggacattcaggcagtg
gcgacctccctcctgccactgacagaagccaacctacgcatgtttcaacgtgcccaggac
gaccttatccctgctgtggaccggcagtttgcctgctcctcctgcgaccacgtctggtgg
cgccgcgtgccccagcggaaggaggtatcccggtgccggaaatgccggaagcgctacgag
ccagtgccagctgacaagatgtggggcctggctgagttccactgcccgaagtgtcggcac
aacttccggggctgggcacagatggggtccccgtccccctgctacgggtgcggcttcccc
gtgtatccaacacggatcctccccccgcgctgggaccgggacccggatcgccgcagcacc
cacactcactcctgctcagctgccgactgctacaaccggcgagagccccacgtgcctggg
acatcctgtgctcaccccaagagccggaagcagaaccacctgcccaaagtgctccacccc
agcaaccctcacattagcagtggctccactgtggccacctgcttgagccagggtggcctc
ctggaagacctggacaacctcatcctggaggacctgaaggaggaggaggaggaagaggag
gaggtggaggacgaggagggcgggcccagggagtga

DBGET integrated database retrieval system