KEGG   Homo sapiens (human): 55343
Entry
55343             CDS       T01001                                 

Gene name
SLC35C1, CDG2C, FUCT1
Definition
(RefSeq) solute carrier family 35 member C1
  KO
K15279  solute carrier family 35 (GDP-fucose transporter), member C1
Organism
hsa  Homo sapiens (human)
Network
nt06015  N-Glycan biosynthesis
  Element
N00824  Transport of GDP-fucose
N00825  Mutation-inactivated SLC35C1 to transport of GDP-fucose
Disease
H00099  Leukocyte adhesion deficiency
H00119  Congenital disorders of glycosylation type II
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55343 (SLC35C1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   55343 (SLC35C1)
SSDB
Motif
Pfam: TPT EamA
Other DBs
NCBI-GeneID: 55343
NCBI-ProteinID: NP_060859
OMIM: 605881
HGNC: 20197
Ensembl: ENSG00000181830
Vega: OTTHUMG00000166519
Pharos: Q96A29(Tbio)
UniProt: Q96A29 B3KQH0
Position
11p11.2
AA seq 364 aa
MNRAPLKRSRILHMALTGASDPSAEAEANGEKPFLLRALQIALVVSLYWVTSISMVFLNK
YLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPGAVDFPSLRLDLRVARSVLPL
SVVFIGMITFNNLCLKYVGVAFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGIIIGG
FWLGVDQEGAEGTLSWLGTVFGVLASLCVSLNAIYTTKVLPAVDGSIWRLTFYNNVNACI
LFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSG
TAKACAQTVLAVLYYEETKSFLWWTSNMMVLGGSSAYTWVRGWEMKKTPEEPSPKDSEKS
AMGV
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgaatagggcccctctgaagcggtccaggatcctgcacatggcgctgaccggggcctca
gacccctctgcagaggcagaggccaacggggagaagccctttctgctgcgggcattgcag
atcgcgctggtggtctccctctactgggtcacctccatctccatggtgttccttaataag
tacctgctggacagcccctccctgcggctggacacccccatcttcgtcaccttctaccag
tgcctggtgaccacgctgctgtgcaaaggcctcagcgctctggccgcctgctgccctggt
gccgtggacttccccagcttgcgcctggacctcagggtggcccgcagcgtcctgcccctg
tcggtggtcttcatcggcatgatcaccttcaataacctctgcctcaagtacgtcggtgtg
gccttctacaatgtgggccgctcactcaccaccgtcttcaacgtgctgctctcctacctg
ctgctcaagcagaccacctccttctatgccctgctcacctgcggtatcatcatcgggggc
ttctggcttggtgtggaccaggagggggcagaaggcaccctgtcgtggctgggcaccgtc
ttcggcgtgctggctagcctctgtgtctcgctcaacgccatctacaccacgaaggtgctc
ccggcggtggacggcagcatctggcgcctgactttctacaacaacgtcaacgcctgcatc
ctcttcctgcccctgctcctgctgctcggggagcttcaggccctgcgtgactttgcccag
ctgggcagtgcccacttctgggggatgatgacgctgggcggcctgtttggctttgccatc
ggctacgtgacaggactgcagatcaagttcaccagtccgctgacccacaatgtgtcgggc
acggccaaggcctgtgcccagacagtgctggccgtgctctactacgaggagaccaagagc
ttcctctggtggacgagcaacatgatggtgctgggcggctcctccgcctacacctgggtc
aggggctgggagatgaagaagactccggaggagcccagccccaaagacagcgagaagagc
gccatgggggtgtga

DBGET integrated database retrieval system