KEGG   Homo sapiens (human): 55344Help
Entry
55344             CDS       T01001                                 

Gene name
PLCXD1, LL0XNC01-136G2.1
Definition
(RefSeq) phosphatidylinositol specific phospholipase C X domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X
Motif
Other DBs
NCBI-GeneID: 55344
NCBI-ProteinID: NP_060860
OMIM: 300974
HGNC: 23148
Ensembl: ENSG00000182378
Vega: OTTHUMG00000022693
Pharos: Q9NUJ7(Tdark)
UniProt: Q9NUJ7
Position
Xp22.33 and Yp11.32-p11.31
AA seq 323 aa AA seqDB search
MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTYCLNKKSPISH
EESRLLQLLNKALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHF
VHMVYTTALVEDTLTEISEWLERHPREVVILACRNFEGLSEDLHEYLVACIKNIFGDMLC
PRGEVPTLRQLWSRGQQVIVSYEDESSLRRHHELWPGVPYWWGNRVKTEALIRYLETMKS
CGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRLSAWVREQCPGPGSRCTNIIA
GDFIGADGFVSDVIALNQKLLWC
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggcaggtgagcgcttccaacagcttctcgaggctgcactgcagaaatgccaac
gaggactggatgtcggcactgtgtccccggctctgggatgtgcccctccaccacctctcc
atcccagggagccacgacacgatgacgtactgcctgaacaagaagtcccccatttcgcac
gaggagtcccggctgctgcagctgctgaacaaggccttgccctgcatcacgcgccctgtc
gtgctgaaatggtccgtcacccaggcactggacgtcacagagcagctggatgccggggtg
cggtacctggacctgcggatagcccacatgctggagggctcggagaagaacctgcacttt
gtccatatggtgtacacaacggcgctggtggaggacacactcacggaaatctcggagtgg
ctggagcggcatccacgcgaggtggtcatcctggcctgcagaaacttcgaggggctgagc
gaggacctgcacgagtacctggtcgcctgtatcaagaacatcttcggggacatgctgtgt
cctcgtggggaggtgccgacactgcggcagctgtggtcccggggccaacaggtcatcgtc
tcctatgaagacgagagctccttgcgccggcaccacgagctgtggccaggagtcccctac
tggtggggaaacagggtgaagaccgaggccctcatccgatacctggagaccatgaagagc
tgcggccgcccaggagggttgttcgtggccggcatcaacctcacggagaacctgcagtac
gttctggcgcacccgtccgagtccctggagaagatgacgctgcccaaccttccgcggctg
agcgcgtgggtccgagagcagtgcccggggccgggttcacggtgcaccaacatcatcgcg
ggggacttcatcggcgcagacggcttcgtcagtgacgtcatcgcgctcaatcagaagctg
ctgtggtgctga

DBGET integrated database retrieval system