KEGG   Homo sapiens (human): 55347Help
Entry
55347             CDS       T01001                                 

Gene name
ABHD10
Definition
(RefSeq) abhydrolase domain containing 10
  KO
K13702  abhydrolase domain-containing protein 10 [EC:3.1.1.93]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    55347 (ABHD10)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.93  mycophenolic acid acyl-glucuronide esterase
     55347 (ABHD10)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   55347 (ABHD10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 DUF2920 DUF818 UPF0227 Rx_N Ser_hydrolase
Motif
Other DBs
NCBI-GeneID: 55347
NCBI-ProteinID: NP_060864
HGNC: 25656
Ensembl: ENSG00000144827
Vega: OTTHUMG00000159280
Pharos: Q9NUJ1(Tbio)
UniProt: Q9NUJ1
Position
3q13.2
AA seq 306 aa AA seqDB search
MAVARLAAVAAWVPCRSWGWAAVPFGPHRGLSVLLARIPQRAPRWLPACRQKTSLSFLNR
PDLPNLAYKKLKGKSPGIIFIPGYLSYMNGTKALAIEEFCKSLGHACIRFDYSGVGSSDG
NSEESTLGKWRKDVLSIIDDLADGPQILVGSSLGGWLMLHAAIARPEKVVALIGVATAAD
TLVTKFNQLPVELKKEVEMKGVWSMPSKYSEEGVYNVQYSFIKEAEHHCLLHSPIPVNCP
IRLLHGMKDDIVPWHTSMQVADRVLSTDVDVILRKHSDHRMREKADIQLLVYTIDDLIDK
LSTIVN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgcgcgcttggcagctgtggcggcctgggtaccttgtcggagctggggctgg
gcagccgtccccttcggtccccaccgtggcctcagcgtgctgcttgcacggatacctcag
cgggcgccacggtggctcccagcttgtagacaaaagacgtcactctcattccttaatcga
ccagaccttccaaacctggcttataagaagctaaaaggcaaaagtccaggaattatcttc
atccctggctatctttcttatatgaatggtacaaaagcgttggcgattgaggagttttgc
aaatctctaggtcacgcctgcataaggtttgattactcaggagttggaagttcagatggt
aactcagaggaaagcacactggggaaatggagaaaagatgttctttctataattgatgac
ttagctgatgggccacagattcttgttggatctagccttggagggtggcttatgcttcat
gctgcaattgcacgaccagagaaggtcgtggctcttattggtgtagctacagctgcagat
accttagtgacaaagtttaatcagcttcctgttgagctaaaaaaggaagtagagatgaaa
ggtgtgtggagcatgccatcaaaatactctgaagaaggagtttataacgttcagtacagt
ttcattaaagaagctgaacatcactgcttgttacatagcccaattcctgtgaactgcccc
ataagattgctccatggcatgaaggatgacattgtaccttggcatacatcaatgcaggtt
gccgatcgagtactcagcacagatgtggatgtcatcctccgaaaacacagtgatcaccga
atgagggaaaaagcagacattcaacttcttgtttacactattgatgacttaattgataag
ctctcaactatagttaactag

DBGET integrated database retrieval system