KEGG   Homo sapiens (human): 5535Help
Entry
5535              CDS       T01001                                 

Gene name
PPP3R2, PPP3RL
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, beta
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04720  Long-term potentiation
hsa04724  Glutamatergic synapse
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05031  Amphetamine addiction
hsa05152  Tuberculosis
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06120  Calcium signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06220  Calcium signaling
  Element
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00180  KSHV K1 to PLCG-calcineurin signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
N00432  HIV gp120 to CXCR4-GNAQ-PLCB/G-calcineurin
N00487  BCR-PLCG-Calcineurin signaling pathway
N00490  HTLV-1 p12 to calcineurin signaling pathway
Drug target
Ciclosporin: D00184
Pimecrolimus: D05480
Ruclosporin: D10983
Tacrolimus (DG00439): D00107 D08556
Voclosporin: D09033
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5535 (PPP3R2)
   04310 Wnt signaling pathway
    5535 (PPP3R2)
   04370 VEGF signaling pathway
    5535 (PPP3R2)
   04020 Calcium signaling pathway
    5535 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    5535 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5535 (PPP3R2)
   04218 Cellular senescence
    5535 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    5535 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    5535 (PPP3R2)
   04660 T cell receptor signaling pathway
    5535 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    5535 (PPP3R2)
   04659 Th17 cell differentiation
    5535 (PPP3R2)
   04662 B cell receptor signaling pathway
    5535 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5535 (PPP3R2)
   04921 Oxytocin signaling pathway
    5535 (PPP3R2)
   04924 Renin secretion
    5535 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    5535 (PPP3R2)
   04720 Long-term potentiation
    5535 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    5535 (PPP3R2)
   04380 Osteoclast differentiation
    5535 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    5535 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5535 (PPP3R2)
   05014 Amyotrophic lateral sclerosis (ALS)
    5535 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    5535 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    5535 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5535 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    5535 (PPP3R2)
   05163 Human cytomegalovirus infection
    5535 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5535 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5535 (PPP3R2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     5535 (PPP3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Motif
Other DBs
NCBI-GeneID: 5535
NCBI-ProteinID: NP_671709
OMIM: 613821
HGNC: 9318
Ensembl: ENSG00000188386
Vega: OTTHUMG00000020386
Pharos: Q96LZ3(Tbio)
UniProt: Q96LZ3 A0A494C014
Position
9q31.1
AA seq 170 aa AA seqDB search
MGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVID
VFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV
GNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgaggccagttacccggcggagatgtgctcccactttgacaatgatgaaatt
aaaaggctgggcaggaggtttaagaagttggacttggacaaatcagggtctctgagcgtg
gaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggcgagtgatcgac
gtcttcgacaccgacggtgatggagaagtggacttcaaggaattcatcctggggacctcc
cagttcagcgtcaagggcgacgaggagcagaagttgaggtttgcgttcagcatttacgac
atggataaagatggctacatttccaacggggagctcttccaggtgctgaagatgatggtg
ggcaacaacctgacggactggcagctccagcagctggtcgacaaaaccatcatcatcctg
gacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtcagagacctg
gagatccacaagaagctggtcctcatcgtatga

DBGET integrated database retrieval system