KEGG   Homo sapiens (human): 55356
Entry
55356             CDS       T01001                                 

Symbol
SLC22A15, FLIPT1, PRO34686
Name
(RefSeq) solute carrier family 22 member 15
  KO
K08211  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 15
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55356 (SLC22A15)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   55356 (SLC22A15)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    55356 (SLC22A15)
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 55356
NCBI-ProteinID: NP_060890
OMIM: 608275
HGNC: 20301
Ensembl: ENSG00000163393
Vega: OTTHUMG00000012008
Pharos: Q8IZD6(Tdark)
UniProt: Q8IZD6
Position
1p13.1
AA seq 547 aa
MEVEEAFQAVGEMGIYQMYLCFLLAVLLQLYVATEAILIALVGATPSYHWDLAELLPNQS
HGNQSAGEDQAFGDWLLTANGSEIHKHVHFSSSFTSIASEWFLIANRSYKVSAASSFFFS
GVFVGVISFGQLSDRFGRKKVYLTGFALDILFAIANGFSPSYEFFAVTRFLVGMMNGGMS
LVAFVLLNECVGTAYWALAGSIGGLFFAVGIAQYALLGYFIRSWRTLAILVNLQGTVVFL
LSLFIPESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFLDLFR
YRVLLGHTLILMFIWFVCSLVYYGLTLSAGDLGGSIYANLALSGLIEIPSYPLCIYLINQ
KWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGKLTISAAFNIVYI
YTSELYPTVIRNVGLGTCSMFSRVGGIIAPFIPSLKYVQWSLPFIVFGATGLTSGLLSLL
LPETLNSPLLETFSDLQVYSYRRLGEEALSLQALDPQQCVDKESSLGSESEEEEEFYDAD
EETQMIK
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggaggtggaggaggcgttccaggcggtgggggagatgggcatctaccagatgtacttg
tgcttcctgctggccgtgctgctgcagctctacgtggccacggaggccatcctcattgca
ctggttggggccacgccatcctaccactgggacctggcagagctcctgccaaatcagagc
cacggtaaccagtcagctggtgaagaccaggcctttggggactggctcctgacagccaac
ggcagtgagatccataagcacgtgcatttcagcagcagcttcacctccatcgcctcggag
tggtttttaattgccaacagatcctacaaagtcagtgcagcaagctcttttttcttcagt
ggtgtatttgttggagttatctcttttggtcagctttcagatcgcttcggaaggaaaaaa
gtctatctcacaggttttgctcttgacatcttatttgcaattgcaaatggattttccccc
tcatatgagttctttgcagtaactcgcttcctggtgggcatgatgaatggagggatgtcg
ctggtggcctttgtcttgcttaatgaatgtgtgggcaccgcctactgggcacttgcagga
tcgattggcggcctgttctttgcagttggcattgcccaatatgccctgttaggatacttc
atccgctcctggaggaccctagccattctggttaacctgcagggaacggtggtctttctc
ttatctttattcattcctgaatcacctcgttggttatactcccagggtcgactgagtgag
gctgaagaggcgctgtacctcattgccaagaggaaccgcaaactcaagtgcacgttctca
ctaacacacccagccaacaggagctgcagggagactggaagtttcctggatctctttcgt
taccgggtcctgttaggacacactttgatcctgatgttcatctggtttgtgtgcagcttg
gtgtattatggcctaactctgagtgcgggtgatctaggtggaagtatttatgccaacctg
gccctgtctggcctcatagagattccatcttaccctctctgtatctacttgattaaccaa
aaatggtttggtcggaagcgaacattatcagcatttctgtgcctaggaggactggcttgt
cttattgtaatgtttcttccagaaaagaaagacacaggtgtgtttgcagtggtgaacagc
cattccttgtccttgctggggaagctgaccatcagtgctgcctttaacattgtttatatc
tacacctctgagctttaccctacagtcatcaggaatgttgggcttggaacttgttccatg
ttctcccgagttggtgggattattgctcccttcatcccctcactgaaatatgtgcaatgg
tctttaccattcattgtcttcggagccacgggtctgacctccggcctcctgagtttgtta
ttgccggagacccttaacagtccgctgctagaaacattctccgaccttcaggtgtattcg
tatcgcaggctgggagaagaagcattatctttacaggctttggacccccaacagtgtgtg
gacaaggagagctctttagggagtgagagtgaggaagaggaagaattttatgatgcagat
gaagagactcagatgatcaagtga

DBGET integrated database retrieval system