KEGG   Homo sapiens (human): 55361Help
Entry
55361             CDS       T01001                                 

Gene name
PI4K2A, PI4KII, PIK42A
Definition
(RefSeq) phosphatidylinositol 4-kinase type 2 alpha
  KO
K13711  phosphatidylinositol 4-kinase type 2 [EC:2.7.1.67]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    55361 (PI4K2A)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    55361 (PI4K2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.67  1-phosphatidylinositol 4-kinase
     55361 (PI4K2A)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    55361 (PI4K2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase Ribosomal_S15
Motif
Other DBs
NCBI-GeneID: 55361
NCBI-ProteinID: NP_060895
OMIM: 609763
HGNC: 30031
Ensembl: ENSG00000155252
Vega: OTTHUMG00000018863
Pharos: Q9BTU6(Tbio)
UniProt: Q9BTU6
Structure
PDB: 

Position
10q24.2
AA seq 479 aa AA seqDB search
MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQP
LLDRARGAAAQGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELA
IERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFG
RDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEK
VPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVL
DYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWR
AYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQI
AVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggacgagacgagcccactagtgtcccccgagcgggcccaacccccggactacaccttc
ccgtcgggctcgggcgctcactttccgcaggtgcccgggggcgcggtccgagtggcggcg
gcggccggctcgggcccctctccgccgggctcgccgggccacgaccgcgagcggcagcca
ctgttggatcgggcccggggcgcggcggcccagggccagacccaaaccgtggcggcgcag
gcccaggctctggccgctcaggccgcggcggcagcccacgccgctcaggcccaccgcgag
cggaacgagttcccggaggatcctgagttcgaggcggtggtgcggcaggccgagctggcc
atcgagcgctgcatctttcccgagcgcatctaccagggctccagcggaagctacttcgtc
aaggaccctcaggggaggatcattgctgtcttcaaacccaagaatgaagagccctatggg
catcttaatcctaagtggaccaagtggctgcagaagctgtgctgtccttgctgctttggc
cgtgactgccttgtccttaaccagggctatctctcagaagcaggggccagcctggtggac
caaaaactggaactcaacattgttccccgtacaaaggtagtatacctggccagtgagacc
ttcaactatagtgccattgaccgagtgaagtccaggggcaagcggcttgcactagagaaa
gtgccaaaagttggacagcggtttaaccgcatcgggctaccaccaaaggttggttcattc
cagctctttgttgaaggctacaaagatgcagactattggctgcggcgttttgaagcagaa
cctcttcctgagaacactaaccggcaactactgctccagtttgagcggttggtggtgctg
gattacatcatccgcaacactgatcgaggcaatgacaactggctgattaaatatgactgt
ccaatggatagttctagctctcgggacacagactgggtggtggtgaaggagcctgttatc
aaggtggctgccatagacaatgggctggccttcccactgaagcatcctgactcctggagg
gcatatcctttttactgggcctggttgccccaggcgaaagtcccattttctcaggagatc
aaagatctgatccttccaaagatatcggaccctaacttcgtcaaggacttggaagaggac
ctatatgaactcttcaagaaagatcctggtttcgacaggggccagttccataagcagatt
gctgtcatgcggggccagatcttaaatctgacccaggccttgaaagacaacaagagtccc
ctgcacctcgtccagatgccacctgtgattgtcgagacggcccgttcccaccagcggtct
tctagcgagtcctacacacagagctttcagagccggaagcccttcttttcatggtggtag

DBGET integrated database retrieval system