KEGG   Homo sapiens (human): 55388
Entry
55388             CDS       T01001                                 

Gene name
MCM10, CNA43, DNA43, PRO2249
Definition
(RefSeq) minichromosome maintenance 10 replication initiation factor
  KO
K10736  minichromosome maintenance protein 10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    55388 (MCM10)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   Other initiation factors
    55388 (MCM10)
SSDB
Motif
Pfam: Mcm10 zf-primase DUF5763
Other DBs
NCBI-GeneID: 55388
NCBI-ProteinID: NP_877428
OMIM: 609357
HGNC: 18043
Ensembl: ENSG00000065328
Vega: OTTHUMG00000017694
Pharos: Q7L590(Tbio)
UniProt: Q7L590
Position
10p13
AA seq 875 aa
MDEEEDNLSLLTALLEENESALDCNSEENNFLTRENGEPDAFDELFDADGDGESYTEEAD
DGETGETRDEKENLATLFGDMEDLTDEEEVPASQSTENRVLPAPAPRREKTNEELQEELR
NLQEQMKALQEQLKVTTIKQTASPARLQKSPVEKSPRPPLKERRVQRIQESTCFSAELDV
PALPRTKRVARTPKASPPDPKSSSSRMTSAPSQPLQTISRNKPSGITRGQIVGTPGSSGE
TTQPICVEAFSGLRLRRPRVSSTEMNKKMTGRKLIRLSQIKEKMAREKLEEIDWVTFGVI
LKKVTPQSVNSGKTFSIWKLNDLRDLTQCVSLFLFGEVHKALWKTEQGTVVGILNANPMK
PKDGSEEVCLSIDHPQKVLIMGEALDLGTCKAKKKNGEPCTQTVNLRDCEYCQYHVQAQY
KKLSAKRADLQSTFSGGRIPKKFARRGTSLKERLCQDGFYYGGVSSASYAASIAAAVAPK
KKIQTTLSNLVVKGTNLIIQETRQKLGIPQKSLSCSEEFKELMDLPTCGARNLKQHLAKA
TASGIMGSPKPAIKSISASALLKQQKQRMLEMRRRKSEEIQKRFLQSSSEVESPAVPSSS
RQPPAQPPRTGSEFPRLEGAPATMTPKLGRGVLEGDDVLFYDESPPPRPKLSALAEAKKL
AAITKLRAKGQVLTKTNPNSIKKKQKDPQDILEVKERVEKNTMFSSQAEDELEPARKKRR
EQLAYLESEEFQKILKAKSKHTGILKEAEAEMQERYFEPLVKKEQMEEKMRNIREVKCRV
VTCKTCAYTHFKLLETCVSEQHEYHWHDGVKRFFKCPCGNRSISLDRLPNKHCSNCGLYK
WERDGMLKEKTGPKIGGETLLPRGEEHAKFLNSLK
NT seq 2628 nt   +upstreamnt  +downstreamnt
atggatgaggaggaagacaatctgtctctgctgaccgcactgctggaagaaaatgagtca
gccttggattgtaattcagaagaaaataacttcttgacgcgggaaaatggcgagcccgac
gcatttgatgagctctttgatgccgacggcgacggtgaatcttatacagaagaggctgat
gatggagaaacaggagagacaagagacgaaaaggaaaatctggccactctctttggagat
atggaggacttaacagatgaagaagaagttcccgcatcacagtcaactgaaaatagggtc
ctccctgctcctgcccccaggcgagagaaaacgaatgaagagttgcaagaggaattaagg
aatttgcaagagcaaatgaaggccttacaagagcagctaaaagtaacaacaattaaacag
acagcaagcccagcccgtctgcaaaaatcccctgtagagaagtctccccggccacctctt
aaggagaggagagttcagagaattcaggagtcaacatgcttttctgcggagcttgatgtc
cctgcgctaccaagaaccaagagggtggctcgaacaccaaaggcttcacctccagatccc
aaaagctcatcttcaaggatgacaagtgcaccctcccaacccctacagacgatttctcgg
aacaaacctagtgggataactagaggtcaaattgtggggaccccaggaagttctggggaa
acgactcaacccatctgtgtggaagccttctctggtctgcggctcaggcggcctcgagta
tcctccacagaaatgaacaagaaaatgaccggccgaaaactgatcagactgtctcagatc
aaggaaaagatggccagagagaagctggaagaaatagattgggtgacatttggggttata
ttgaagaaggttacgccacagagtgtgaatagtggaaaaaccttcagcatatggaaactg
aatgatcttcgtgacctgacacaatgtgtgtccttgttcttatttggagaagttcacaaa
gcgctctggaagacggagcaggggactgtcgtagggatcctcaatgccaaccccatgaag
cccaaggatggttcagaggaggtgtgtttatctatcgatcatcctcagaaggtcttaatt
atgggtgaagctcttgacctgggaacctgtaaagccaagaagaagaatggagagccgtgc
acgcagactgtgaatttgcgtgactgtgagtactgtcagtaccatgtccaggctcagtac
aagaagctcagcgcaaagcgtgcggatctgcagtccaccttctctggaggacgaattcca
aagaagtttgcccgcagaggcaccagcctcaaagaacggctgtgccaagatggcttttac
tacggaggggtttcttctgcctcgtatgcagcttcaattgcagcagctgtggctcctaag
aagaagattcaaaccactctgagtaatctggttgttaagggcacaaacttgatcatccag
gaaacacggcaaaaactcggaataccccagaagagcctgtcttgctctgaggagttcaag
gaactgatggacctgccgacgtgtggagccaggaacttaaaacaacatttagccaaagcc
acagcttcagggattatggggagcccaaaaccagccatcaagtccatctcggcctcagca
ctcttgaagcaacagaagcagcggatgttggagatgaggagaaggaaatcagaagaaata
cagaagcgatttctgcagagctcaagtgaagttgagagcccagctgtgccatcttcatca
agacagccccctgctcagcctccacggacaggatccgagttccccaggctggagggagcc
ccggccacaatgacgcccaagctggggcgaggtgtcttggaaggagatgatgttctcttt
tatgatgagtcaccaccaccaagaccaaaactgagtgctttagcagaagccaaaaagtta
gctgctatcaccaaattaagggcaaaaggccaggttcttacaaaaacaaacccaaacagc
attaagaagaaacaaaaggaccctcaggacatcctggaggtgaaggaacgtgtagaaaaa
aacaccatgttttcttctcaagctgaggatgaattggagcctgccaggaaaaaaaggaga
gaacaacttgcctatctggaatctgaggaatttcagaaaatcctaaaagcaaaatcaaaa
cacacaggcatcctgaaagaggccgaggctgagatgcaggagcgctactttgagccactg
gtgaaaaaagaacaaatggaagaaaagatgagaaacatcagagaagtgaagtgccgtgtc
gtgacatgcaagacgtgcgcctatacccacttcaagctgctggagacctgcgtcagtgag
cagcatgaataccactggcatgatggtgtgaagaggtttttcaaatgtccctgtggaaac
agaagcatctccttggacagactcccgaacaagcactgcagtaactgtggcctctacaaa
tgggaacgggacggaatgctaaaggaaaagactggtccaaagataggaggagaaactctg
ttaccaagaggagaagaacatgctaaatttctgaacagccttaaataa

DBGET integrated database retrieval system