KEGG   Homo sapiens (human): 5539
Entry
5539              CDS       T01001                                 

Gene name
PPY, PNP, PP
Definition
(RefSeq) pancreatic polypeptide
  KO
K05234  pancreatic polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5539 (PPY)
SSDB
Motif
Pfam: Hormone_3
Other DBs
NCBI-GeneID: 5539
NCBI-ProteinID: NP_002713
OMIM: 167780
HGNC: 9327
Ensembl: ENSG00000108849
Vega: OTTHUMG00000181800
Pharos: P01298(Tbio)
CPD: C16117
UniProt: P01298
Position
17q21.31
AA seq 95 aa
MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINML
TRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL
NT seq 288 nt   +upstreamnt  +downstreamnt
atggctgccgcacgcctctgcctctccctgctgctcctgtccacctgcgtggctctgtta
ctacagccactgctgggtgcccagggagccccactggagccagtgtacccaggggacaat
gccacaccagagcagatggcccagtatgcagctgatctccgtagatacatcaacatgctg
accaggcctaggtatgggaaaagacacaaagaggacacgctggccttctcggagtggggg
tccccgcatgctgctgtccccagggagctcagcccgctggacttataa

DBGET integrated database retrieval system