KEGG   Homo sapiens (human): 5542
Entry
5542              CDS       T01001                                 

Gene name
PRB1, PM, PMF, PMS, PRB1L, PRB1M
Definition
(RefSeq) proline rich protein BstNI subfamily 1
  KO
K13911  basic salivary proline-rich protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    5542 (PRB1)
SSDB
Motif
Pfam: Pro-rich
Other DBs
NCBI-GeneID: 5542
NCBI-ProteinID: NP_005030
OMIM: 180989
HGNC: 9337
Ensembl: ENSG00000251655
Vega: OTTHUMG00000157263
Pharos: P04280(Tdark)
UniProt: P04280
Position
12p13.2
AA seq 331 aa
MLLILLSVALLALSSAQNLNEDVSQEESPSLIAGNPQGPSPQGGNKPQGPPPPPGKPQGP
PPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQG
PPPQGGNRPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQ
GPPPQGGKKPQGPPPPGKPQGPPPQGDKSRSSQSPPGKPQGPPPQGGNQPQGPPPPPGKP
QGPPPQGGNKPQGPPPPGKPQGPPAQGGSKSQSARSPPGKPQGPPQQEGNNPQGPPPPAG
GNPQQPQAPPAGQPQGPPRPPQGGRPSRPPQ
NT seq 996 nt   +upstreamnt  +downstreamnt
atgctgttgattctgctgtcagtggccttgctggccctgagctcagctcagaacttaaat
gaagatgtcagccaggaagaatctccctccctaatagcaggaaatccacaaggaccatcc
ccacaaggaggcaacaagccccagggccccccacctcctccaggaaagccacaaggacca
cccccacaaggaggcaacaaacctcaaggtcccccacctccaggaaagccacaaggacca
cccccacaaggggacaagtcccgaagtccccgatctcctccaggaaaaccacaaggacca
cccccacaaggaggtaaccagccccaaggtcccccacctcctccaggaaagccacaagga
ccacccccacaaggaggcaacagacctcaaggtcccccacctccaggaaagccacaagga
ccacccccacaaggagacaagtcccgaagtccccgatctcctccaggaaagccacaagga
ccacccccacaaggaggtaaccaaccccaaggtcccccacctcctccaggaaagccacaa
ggaccacccccacaaggaggcaagaaacctcagggtcccccacctccaggaaagccacaa
ggaccacccccacaaggagacaagtcccgaagttcccaatctcctccaggaaagccacaa
ggaccacccccacaaggaggcaaccagccccaaggtcccccacctcctccaggaaagcca
caaggaccacccccacaaggaggcaacaaacctcaaggtcccccacctccaggaaagcca
caaggaccacccgcacaaggaggcagcaagtcccaaagtgcccgatctcctccaggaaag
ccacaaggaccaccccaacaagaaggcaacaatcctcaaggtcccccacctccagcagga
ggcaatccccagcagcctcaggcacctcctgctggacagccccagggaccaccacgccct
cctcaagggggcagaccttccagacctccccagtga

DBGET integrated database retrieval system