KEGG   Homo sapiens (human): 55423Help
Entry
55423             CDS       T01001                                 

Gene name
SIRPG, CD172g, SIRP-B2, SIRPB2, SIRPgamma, bA77C3.1
Definition
(RefSeq) signal regulatory protein gamma
  KO
K06551  signal-regulatory protein alpha/beta1/gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    55423 (SIRPG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    55423 (SIRPG)
   04090 CD molecules [BR:hsa04090]
    55423 (SIRPG)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  SIRP family
   55423 (SIRPG)
CD molecules [BR:hsa04090]
 Proteins
  55423 (SIRPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1-set Ig_3 C2-set_2 V-set Ig_2 ig I-set
Motif
Other DBs
NCBI-GeneID: 55423
NCBI-ProteinID: NP_061026
OMIM: 605466
HGNC: 15757
Ensembl: ENSG00000089012
Vega: OTTHUMG00000031680
Pharos: Q9P1W8(Tbio)
UniProt: Q9P1W8
Structure
PDB: 

Position
20p13
AA seq 387 aa AA seqDB search
MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVGKTATLHCTVTSLLP
VGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCV
KFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITL
KWFKNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPLRG
TANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFYPQSLQLTWSENGNVCQRETASTL
TENKDGTYNWTSWFLVNISDQRDDVVLTCQVKHDGQLAVSKRLALEVTVHQKDQSSDATP
GPASSLTALLLIAVLLGPIYVPWKQKT
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcccagcctcctggccccatcctcctggtcctttcctgcttctgactctactg
ctgggacttacagaagtggcaggtgaggaggagctacagatgattcagcctgagaagctc
ctgttggtcacagttggaaagacagccactctgcactgcactgtgacctccctgcttccc
gtgggacccgtcctgtggttcagaggagttggaccaggccgggaattaatctacaatcaa
aaagaaggccacttccccagggtaacaacagtttcagacctcacaaagagaaacaacatg
gacttttccatccgcatcagtagcatcaccccagcagatgtcggcacatactactgtgtg
aagtttcgaaaagggagccctgagaacgtggagtttaagtctggaccaggcactgagatg
gctttgggtgccaaaccctctgcccccgtggtattgggccctgcggcgaggaccacacct
gagcatacagtgagtttcacctgtgagtcccatggcttctctcccagagacatcaccctg
aaatggttcaaaaatgggaatgagctctcagacttccagaccaacgtggaccccacagga
cagagtgtggcctacagcatccgcagcacagccagggtggtactggacccctgggacgtt
cgctctcaggtcatctgcgaggtggcccatgtcaccttgcagggggaccctcttcgtggg
actgccaacttgtctgaggccatccgagttccacccaccttggaggttactcaacagccc
atgagggtggggaaccaggtaaacgtcacctgccaggtgaggaagttctacccccagagc
ctacagctgacctggtcggagaatggaaacgtgtgccagagagaaacagcctcgaccctt
acagagaacaaggatggtacctacaactggacaagctggttcctggtgaacatatctgac
caaagggatgatgtggtcctcacctgccaggtgaagcatgatgggcagctggcggtcagc
aaacgccttgccctagaggtcacagtccaccagaaggaccagagctcagatgctacccct
ggcccggcatcatcccttactgcgctgctcctcatagctgtcctcctgggccccatctac
gtcccctggaagcagaagacctga

DBGET integrated database retrieval system