KEGG   Homo sapiens (human): 55425
Entry
55425             CDS       T01001                                 

Gene name
GPALPP1, AD029, KIAA1704, LSR7, bA245H20.2
Definition
(RefSeq) GPALPP motifs containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF3752
Other DBs
NCBI-GeneID: 55425
NCBI-ProteinID: NP_001303880
HGNC: 20298
Ensembl: ENSG00000133114
Vega: OTTHUMG00000016841
Pharos: Q8IXQ4(Tdark)
UniProt: Q8IXQ4 A0A024RDS7
Position
13q14.12
AA seq 340 aa
MARDLIGPALPPGFKARGTAEDEERDPSPVAGPALPPNYKSSSSDSSDSDEDSSSLYEEG
NQESEEDDSGPTARKQRKNQDDDDDDDDGFFGPALPPGFKKQDDSPPRPIIGPALPPGFI
KSTQKSDKGRDDPGQQETDSSEDEDIIGPMPAKGPVNYNVTTEFEKRAQRMKEKLTKGDD
DSSKPIVRESWMTELPPEMKDFGLGPRTFKRRADDTSGDRSIWTDTPADRERKAKETQEA
RKSSSKKDEEHILSGRDKRLAEQVSSYNESKRSESLMDIHHKKLKSKAAEDKNKPQERIP
FDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKGNMFL
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggcaagagacctgatcggaccggccctgccgcccggcttcaaggcccgcggaacagcg
gaggacgaagagcgggacccgagccctgttgcaggaccagctctgccccctaattataaa
agcagtagttcagattcatcagacagcgatgaagacagtagttctttgtacgaagaagga
aatcaagaatctgaagaagatgacagtggtccaactgcaagaaaacagaggaaaaatcag
gatgatgacgatgatgatgatgatgggttttttggaccagcccttcctcctggatttaaa
aagcaggatgattctcctccaaggcccataataggtcctgcattgccacctggtttcatt
aaatctacacagaaaagtgacaagggcagagatgatccaggacaacaggaaacagacagc
agtgaagatgaggatattattggaccaatgcctgcaaaaggaccagttaactataatgta
acgacagagtttgaaaaaagggcccagagaatgaaagaaaaactgaccaaaggagatgat
gattcatctaaacccattgtaagagagtcatggatgactgaacttcctccagaaatgaaa
gactttggtcttgggccaaggacttttaagagaagagctgatgacacatctggagatcga
tcaatctggacagatactccagctgatagggaaaggaaagctaaggaaacacaagaagca
aggaagtcatccagtaagaaagatgaagaacatatattatcaggaagagataagagactg
gctgagcaggtatcttcatacaatgaatcaaaaagatcagaatctcttatggacatacat
cataaaaagttaaagagtaaggctgctgaagacaaaaataagcctcaagagagaatacca
tttgaccgtgataaagatctcaaggttaatcggtttgatgaagctcagaaaaaagcccta
ataaaaaaatctagagaactaaacaccagattttcacacggcaaaggcaatatgttttta
taa

DBGET integrated database retrieval system