KEGG   Homo sapiens (human): 55437Help
Entry
55437             CDS       T01001                                 

Gene name
STRADB, ALS2CR2, CALS-21, ILPIP, ILPIPA, PAPK, PRO1038
Definition
(RefSeq) STE20 related adaptor beta
  KO
K17532  STE20-related kinase adapter protein beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    55437 (STRADB)
   04150 mTOR signaling pathway
    55437 (STRADB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    55437 (STRADB)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   55437 (STRADB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like ASXH DUF1824
Motif
Other DBs
NCBI-GeneID: 55437
NCBI-ProteinID: NP_061041
OMIM: 607333
HGNC: 13205
Ensembl: ENSG00000082146
Vega: OTTHUMG00000132831
Pharos: Q9C0K7(Tbio)
UniProt: Q9C0K7 A0A024R420
Position
2q33.1
AA seq 418 aa AA seqDB search
MSLLDCFCTSRTQVESLRPEKQSETSIHQYLVDEPTLSWSRPSTRASEVLCSTNVSHYEL
QVEIGRGFDNLTSVHLARHTPTGTLVTIKITNLENCNEERLKALQKAVILSHFFRHPNIT
TYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPEGMSETLIRNILFGAVRGLNYLHQNGC
IHRSIKASHILISGDGLVTLSGLSHLHSLVKHGQRHRAVYDFPQFSTSVQPWLSPELLRQ
DLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESR
MKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSA
SSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttttggattgcttctgcacttcaagaacacaagttgaatcactcagacctgaa
aaacagtctgaaaccagtatccatcaatacttggttgatgagccaaccctttcctggtca
cgtccatccactagagccagtgaagtactatgttccaccaacgtttctcactatgagctc
caagtagaaataggaagaggatttgacaacttgacttctgtccatcttgcacggcatact
cccacaggaacactggtaactataaaaattacaaatctggaaaactgcaatgaagaacgc
ctgaaagctttacagaaagccgtgattctatcccactttttccggcatcccaatattaca
acttattggacagttttcactgttggcagctggctttgggttatttctccatttatggcc
tatggttcagcaagtcaactcttgaggacctattttcctgaaggaatgagtgaaacttta
ataagaaacattctctttggagccgtgagagggttgaactatctgcaccaaaatggctgt
attcacaggagtattaaagccagccatatcctcatttctggtgatggcctagtgaccctc
tctggcctgtcccatctgcatagtttggttaagcatggacagaggcatagggctgtgtat
gatttcccacagttcagcacatcagtgcagccgtggctgagtccagaactactgagacag
gatttacatgggtataatgtgaagtcagatatttacagtgttgggattacagcatgtgaa
ttagccagtgggcaggtgcctttccaggacatgcatagaactcagatgctgttacagaaa
ctgaaaggtcctccttatagcccattggatatcagtattttccctcaatcagaatccaga
atgaaaaattcccagtcaggtgtagactctgggattggagaaagtgtgcttgtctccagt
ggaactcacacagtaaatagtgaccgattacacacaccatcctcaaaaactttctctcct
gccttctttagcttggtacagctctgtttgcaacaagatcctgagaaaaggccatcagca
agcagtttattgtcccatgttttcttcaaacagatgaaagaagaaagccaggattcaata
ctttcactgttgcctcctgcttataacaagccatcaatatcattgcctccagtgttacct
tggactgagccagaatgtgattttcctgatgaaaaagactcatactgggaattctag

KEGG   Homo sapiens (human): 92335Help
Entry
92335             CDS       T01001                                 

Gene name
STRADA, LYK5, NY-BR-96, PMSE, STRAD, STRAD_alpha, Stlk
Definition
(RefSeq) STE20 related adaptor alpha
  KO
K08271  STE20-related kinase adapter protein alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04152  AMPK signaling pathway
Disease
H01112  Polyhydramnios, megalencephaly, and symptomatic epilepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    92335 (STRADA)
   04150 mTOR signaling pathway
    92335 (STRADA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    92335 (STRADA)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   92335 (STRADA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 92335
NCBI-ProteinID: NP_001003787
OMIM: 608626
HGNC: 30172
Ensembl: ENSG00000266173
Vega: OTTHUMG00000178908
Pharos: Q7RTN6(Tbio)
UniProt: Q7RTN6
Structure
PDB: 

Position
17q23.3
AA seq 431 aa AA seqDB search
MSFLVSKPERIRRWVSEKFIVEGLRDLELFGEQPPGDTRRKTNDASSESIASFSKQEVMS
SFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELH
VSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVL
KALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKV
LPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLL
DTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCL
QRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTN
LEELEVDDWEF
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttcttgtaagtaaaccagagcgaatcaggcggtgggtctcggaaaagttcatt
gttgagggcttaagagatttggaactatttggagagcagcctccgggtgacactcggaga
aaaaccaatgatgcgagctcagagtcaatagcatccttctctaaacaggaggtcatgagt
agctttctgccagagggagggtgttacgagctgctcactgtgataggcaaaggatttgag
gacctgatgactgtgaatctagcaaggtacaaaccaacaggagagtacgtgactgtacgg
aggattaacctagaagcttgttccaatgagatggtaacattcttgcagggcgagctgcat
gtctccaaactcttcaaccatcccaatatcgtgccatatcgagccacttttattgcagac
aatgagctgtgggttgtcacatcattcatggcatacggttctgcaaaagatctcatctgt
acacacttcatggatggcatgaatgagctggcgattgcttacatcctgcagggggtgctg
aaggccctcgactacatccaccacatgggatatgtacacaggagtgtcaaagccagccac
atcctgatctctgtggatgggaaggtctacctgtctggtttgcgcagcaacctcagcatg
ataagccatgggcagcggcagcgagtggtccacgattttcccaagtacagtgtcaaggtt
ctgccgtggctcagccccgaggtcctccagcagaatctccagggttatgatgccaagtct
gacatctacagtgtgggaatcacagcctgtgaactggccaacggccatgtcccctttaag
gatatgcctgccacccagatgctgctagagaaactgaacggcacagtgccctgcctgttg
gataccagcaccatccccgctgaggagctgaccatgagcccttcgcgctcagtggccaac
tctggcctgagtgacagcctgaccaccagcaccccccggccctccaacggtgactcgccc
tcccacccctaccaccgaaccttctccccccacttccaccactttgtggagcagtgcctt
cagcgcaacccggatgccaggcccagtgccagcaccctcctgaaccactctttcttcaag
cagatcaagcgacgtgcctcagaggctttgcccgaattgcttcgtcctgtcacccccatc
accaattttgagggcagccagtctcaggaccacagtggaatctttggcctggtaacaaac
ctggaagagctggaggtggacgattgggagttctga

DBGET integrated database retrieval system