KEGG   Homo sapiens (human): 5547Help
Entry
5547              CDS       T01001                                 

Gene name
PRCP, HUMPCP, PCP
Definition
(RefSeq) prolylcarboxypeptidase
  KO
K01285  lysosomal Pro-X carboxypeptidase [EC:3.4.16.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    5547 (PRCP)
  09154 Digestive system
   04974 Protein digestion and absorption
    5547 (PRCP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    5547 (PRCP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.2  lysosomal Pro-Xaa carboxypeptidase
     5547 (PRCP)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S28
   5547 (PRCP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S28 Hydrolase_4 Peptidase_S37 DUF2920 Peptidase_S9 Abhydrolase_6 Abhydrolase_1
Motif
Other DBs
NCBI-GeneID: 5547
NCBI-ProteinID: NP_005031
OMIM: 176785
HGNC: 9344
Ensembl: ENSG00000137509
Vega: OTTHUMG00000166899
Pharos: P42785(Tchem)
UniProt: P42785 A0A024R5L0
Structure
PDB: 

Position
11q14.1
AA seq 496 aa AA seqDB search
MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHF
GFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFA
EHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSY
GGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRS
WDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYPYASNFLQP
LPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWS
YQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHT
NIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRH
MKNWIRDFYDSAGKQH
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgggccgccgagccctcctgctcctgcttctgtcttttctggcgccctgggccaccata
gccctccggccggccttaagggccctcggcagcctacacttgccaaccaaccccacatcc
ctcccggctgtagccaagaactattcggttctctacttccaacagaaggttgatcatttt
ggatttaatactgtgaaaacttttaatcagcggtacctagtagctgataaatactggaag
aaaaatggtggatcaatacttttctacactggtaatgaaggggacattatctggttttgt
aataacacggggttcatgtgggatgtggctgaggaactgaaagctatgttggtgtttgct
gaacatcgatactatggagagtctctcccctttggtgacaactcattcaaggattccaga
cacttgaatttcctgacatcagaacaagctctggctgattttgcagagttaatcaaacac
ttgaaaagaacaatcccaggagctgaaaatcaacctgtcattgccataggaggctcctat
ggtggcatgcttgccgcctggtttaggatgaaatatcctcatatggtagttggagctctt
gcagcttctgcccctatctggcagtttgaggatttagtaccttgtggtgtatttatgaag
atcgtaactacagattttaggaaaagcggtccacattgttcagagagcatccacaggtcc
tgggatgccattaatcgactctcaaatactggcagtggtttgcagtggcttactggagcc
cttcacttatgcagcccattaacttctcaggacatccaacatttgaaagactggatctct
gaaacctgggtgaatctggcaatggtggactatccttatgcctctaactttttacagcct
ttgcctgcttggcctatcaaggtagtgtgccagtatttgaaaaatcccaatgtatctgat
tcactgctgctgcagaatattttccaagctctgaatgtatattacaattattcgggccag
gtgaaatgcctgaatatttcagagacagcaactagcagtctgggaacactgggttggagc
tatcaggcctgcacagaagtagtcatgcccttttgtactaatggtgtcgatgacatgttt
gaacctcactcatggaacttaaaggaactttctgatgactgttttcaacagtggggtgtg
agaccaaggccctcctggatcactactatgtatggaggcaaaaacattagttcacacaca
aacattgttttcagcaatggtgaactagacccctggtcaggaggtggagtaactaaggat
atcacagacactctggttgcagtcaccatctcagagggggcccaccacttagatctccgc
accaagaatgccttggatcctatgtctgtgctgttagcccgctccttggaagttagacat
atgaagaattggatcagagatttctatgacagtgcgggaaagcagcactga

DBGET integrated database retrieval system