KEGG   Homo sapiens (human): 5549Help
Entry
5549              CDS       T01001                                 

Gene name
PRELP, MST161, MSTP161, SLRR2A
Definition
(RefSeq) proline and arginine rich end leucine rich repeat protein
  KO
K08125  proline arginine-rich end leucine-rich repeat protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    5549 (PRELP)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class II
    5549 (PRELP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRR_9 LRRNT
Motif
Other DBs
NCBI-GeneID: 5549
NCBI-ProteinID: NP_002716
OMIM: 601914
HGNC: 9357
Ensembl: ENSG00000188783
Vega: OTTHUMG00000035911
Pharos: P51888(Tbio)
UniProt: P51888
Position
1q32.1
AA seq 382 aa AA seqDB search
MRSPLCWLLPLLILASVAQGQPTRRPRPGTGPGRRPRPRPRPTPSFPQPDEPAEPTDLPP
PLPPGPPSIFPDCPRECYCPPDFPSALYCDSRNLRKVPVIPPRIHYLYLQNNFITELPVE
SFQNATGLRWINLDNNRIRKIDQRVLEKLPGLVFLYMEKNQLEEVPSALPRNLEQLRLSQ
NHISRIPPGVFSKLENLLLLDLQHNRLSDGVFKPDTFHGLKNLMQLNLAHNILRKMPPRV
PTAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH
NRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVPHLRYLRLDGN
YLKPPIPLDLMMCFRLLQSVVI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcacccctctgctggctcctcccacttctcatcttggcctcagtggcccaaggc
cagccaacaagacgaccaagacccgggactgggcccgggcgcagacccaggcccaggccc
aggcccacacccagctttcctcagcctgatgaaccagcagagccaacagacctgcctcct
cccctccctccaggccctccatctatcttccctgactgtccccgcgaatgctactgcccc
cctgatttcccatctgccctctactgtgatagccgcaacctgcgaaaggtccctgtcatc
ccgccccgcatccattacctctatctccagaacaacttcatcactgagctcccggtggag
tccttccagaatgccacaggcctgcgatggattaacctggacaacaaccgaatccgcaag
atagaccagagggtgctggagaaactgcccggcctggtgttcctctacatggagaagaac
cagttggaagaggtcccctcggccctgccccggaacctggagcagctgaggctgagccag
aaccacatctccagaatcccgcctggtgtcttcagcaagctggagaacctgctgctcctg
gatctccagcacaacaggctgagcgacggcgtcttcaagcccgacaccttccatggcctc
aagaacctcatgcagctcaacctggcccacaacatcctgagaaagatgccgcccagggtc
cccaccgccattcaccagctctacctggacagtaacaagattgagaccatccctaacgga
tacttcaagagctttcccaatcttgccttcattcggcttaactacaacaagctgacagac
aggggactccccaagaactcctttaatatctccaacctgcttgtgctccacctgtcccac
aacaggatcagcagtgtgcccgccatcaacaacaggctggaacacctgtacctcaacaac
aatagcatcgagaaaatcaacggaacccagatttgccccaacgacctagtggcgttccat
gacttctcctcggacctggagaacgtgccacacctgcgctacctgcggctggatggaaac
tacttgaagccgcccatcccgctggacctcatgatgtgcttccgcctcctgcagtccgtg
gtcatctag

DBGET integrated database retrieval system