KEGG   Homo sapiens (human): 5550Help
Entry
5550              CDS       T01001                                 

Gene name
PREP, PE, PEP
Definition
(RefSeq) prolyl endopeptidase
  KO
K01322  prolyl oligopeptidase [EC:3.4.21.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    5550 (PREP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.26  prolyl oligopeptidase
     5550 (PREP)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   5550 (PREP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S9_N Peptidase_S9 Esterase Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 5550
NCBI-ProteinID: NP_002717
OMIM: 600400
HGNC: 9358
Ensembl: ENSG00000085377
Vega: OTTHUMG00000015297
Pharos: P48147(Tchem)
UniProt: P48147 B2RAH7
Structure
PDB: 

Position
6q21
AA seq 710 aa AA seqDB search
MLSLQYPDVYRDETAVQDYHGHKICDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIR
GLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNILS
DDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTH
DGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEFPDEPKWMGGAEL
SDDGRYVLLSIREGCDPVNRLWYCDLQQESSGIAGILKWVKLIDNFEGEYDYVTNEGTVF
TFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKDVLEWIACVRSNFLVLCYLHDVKNI
LQLHDLTTGALLKTFPLDVGSIVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPR
VFREVTVKGIDASDYQTVQIFYPSKDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISI
TPNYSVSRLIFVRHMGGILAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKE
GYTSPKRLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYG
CSDSKQHFEWLVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIV
GRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDWIP
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccttcagtaccccgacgtgtaccgcgacgagaccgccgtacaggattatcat
ggtcataaaatttgtgacccttacgcctggcttgaagaccccgacagtgaacagactaag
gcctttgtggaggcccagaataagattactgtgccatttcttgagcagtgtcccatcaga
ggtttatacaaagagagaatgactgaactatatgattatcccaagtatagttgccacttc
aagaaaggaaaacggtatttttatttttacaatacaggtttgcagaaccagcgagtatta
tatgtacaggattccttagagggtgaggccagagtgttcctggaccccaacatactgtct
gacgatggcacagtggcactccgaggttatgcgttcagcgaagatggtgaatattttgcc
tatggtctgagtgccagtggctcagactgggtgacaatcaagttcatgaaagttgatggt
gccaaagagcttccagatgtgcttgaaagagtcaagttcagctgtatggcctggacccat
gatgggaagggaatgttctacaactcataccctcaacaggatggaaaaagtgatggcaca
gagacatctaccaatctccaccaaaagctctactaccatgtcttgggaaccgatcagtca
gaagatattttgtgtgctgagtttcctgatgaacctaaatggatgggtggagctgagtta
tctgatgatggccgctatgtcttgttatcaataagggaaggatgtgatccagtaaaccga
ctctggtactgtgacctacagcaggaatccagtggcatcgcgggaatcctgaagtgggta
aaactgattgacaactttgaaggggaatatgactacgtgaccaatgaggggacggtgttc
acattcaagacgaatcgccagtctcccaactatcgcgtgatcaacattgacttcagggat
cctgaagagtctaagtggaaagtacttgttcctgagcatgagaaagatgtcttagaatgg
atagcttgtgtcaggtccaacttcttggtcttatgctacctccatgacgtcaagaacatt
ctgcagctccatgacctgactactggtgctctccttaagaccttcccgctcgatgtcggc
agcattgtagggtacagcggtcagaagaaggacactgaaatcttctatcagtttacttcc
tttttatctccaggtatcatttatcactgtgatcttaccaaagaggagctggagccaaga
gttttccgagaggtgaccgtaaaaggaattgatgcttctgattaccagacagtccagatt
ttctaccctagcaaggatggtacgaagattccaatgttcattgtgcataaaaaaggcata
aaattggatggctctcatccagctttcttatatggctatggcggcttcaacatatccatc
acacccaactacagtgtttccaggcttatttttgtgagacacatgggtggtatcctggca
gtggccaacatcagaggaggtggcgaatatggagagacgtggcataaaggtggtatcttg
gccaacaaacaaaactgctttgatgactttcagtgtgctgctgagtatctgatcaaggaa
ggttacacatctcccaagaggctgactattaatggaggttcaaatggaggcctcttagtg
gctgcttgtgcaaatcagagacctgacctctttggttgtgttattgcccaagttggagta
atggacatgctgaagtttcataaatataccatcggccatgcttggaccactgattatggg
tgctcggacagcaaacaacactttgaatggcttgtcaaatactctccattgcataatgtg
aagttaccagaagcagatgacatccagtacccgtccatgctgctcctcactgctgaccat
gatgaccgcgtggtcccgcttcactccctgaagttcattgccacccttcagtacatcgtg
ggccgcagcaggaagcaaagcaaccccctgcttatccacgtggacaccaaggcgggccac
ggggcggggaagcccacagccaaagtgatagaggaagtctcagacatgtttgcgttcatc
gcgcggtgcctgaacgtcgactggattccataa

DBGET integrated database retrieval system