KEGG   Homo sapiens (human): 55501Help
Entry
55501             CDS       T01001                                 

Gene name
CHST12, C4S-2, C4ST-2, C4ST2
Definition
(RefSeq) carbohydrate sulfotransferase 12
  KO
K04742  chondroitin 4-sulfotransferase 12 [EC:2.8.2.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    55501 (CHST12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    55501 (CHST12)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.5  chondroitin 4-sulfotransferase
     55501 (CHST12)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   55501 (CHST12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfotransfer_2
Motif
Other DBs
NCBI-GeneID: 55501
NCBI-ProteinID: NP_001230723
OMIM: 610129
HGNC: 17423
Ensembl: ENSG00000136213
Vega: OTTHUMG00000023849
Pharos: Q9NRB3(Tbio)
UniProt: Q9NRB3 A0A024R860
Position
7p22.3
AA seq 414 aa AA seqDB search
MTKARLFRLWLVLGSVFMILLIIVYWDSAGAAHFYLHTSFSRPHTGPPLPTPGPDRDREL
TADSDVDEFLDKFLSAGVKQSDLPRKETEQPPAPGSMEESVRGYDWSPRDARRSPDQGRQ
QAERRSVLRGFCANSSLAFPTKERAFDDIPNSELSHLIVDDRHGAIYCYVPKVACTNWKR
VMIVLSGSLLHRGAPYRDPLRIPREHVHNASAHLTFNKFWRRYGKLSRHLMKVKLKKYTK
FLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYANHTSLPASAREAFRAGLKVSF
ANFIQYLLDPHTEKLAPFNEHWRQVYRLCHPCQIDYDFVGKLETLDEDAAQLLQLLQVDR
QLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcccggctgttccggctgtggctggtgctggggtcggtgttcatgatcctg
ctgatcatcgtgtactgggacagcgcaggcgccgcgcacttctacttgcacacgtccttc
tctaggccgcacacggggccgccgctgcccacgcccgggccggacagggacagggagctc
acggccgactccgatgtcgacgagtttctggacaagtttctcagtgctggcgtgaagcag
agcgaccttcccagaaaggagacggagcagccgcctgcgccggggagcatggaggagagc
gtgagaggctacgactggtccccgcgcgacgcccggcgcagcccagaccagggccggcag
caggcggagcggaggagcgtgctgcggggcttctgcgccaactccagcctggccttcccc
accaaggagcgcgcattcgacgacatccccaactcggagctgagccacctgatcgtggac
gaccggcacggggccatctactgctacgtgcccaaggtggcctgcaccaactggaagcgc
gtgatgatcgtgctgagcggaagcctgctgcaccgcggtgcgccctaccgcgacccgctg
cgcatcccgcgcgagcacgtgcacaacgccagcgcgcacctgaccttcaacaagttctgg
cgccgctacgggaagctctcccgccacctcatgaaggtcaagctcaagaagtacaccaag
ttcctcttcgtgcgcgaccccttcgtgcgcctgatctccgccttccgcagcaagttcgag
ctggagaacgaggagttctaccgcaagttcgccgtgcccatgctgcggctgtacgccaac
cacaccagcctgcccgcctcggcgcgcgaggccttccgcgctggcctcaaggtgtccttc
gccaacttcatccagtacctgctggacccgcacacggagaagctggcgcccttcaacgag
cactggcggcaggtgtaccgcctctgccacccgtgccagatcgactacgacttcgtgggg
aagctggagactctggacgaggacgccgcgcagctgctgcagctactccaggtggaccgg
cagctccgcttccccccgagctaccggaacaggaccgccagcagctgggaggaggactgg
ttcgccaagatccccctggcctggaggcagcagctgtataaactctacgaggccgacttt
gttctcttcggctaccccaagcccgaaaacctcctccgagactga

DBGET integrated database retrieval system