KEGG   Homo sapiens (human): 55504Help
Entry
55504             CDS       T01001                                 

Gene name
TNFRSF19, TAJ, TAJ-alpha, TRADE, TROY
Definition
(RefSeq) TNF receptor superfamily member 19
  KO
K05155  tumor necrosis factor receptor superfamily member 19
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    55504 (TNFRSF19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    55504 (TNFRSF19)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   55504 (TNFRSF19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 bZIP_C
Motif
Other DBs
NCBI-GeneID: 55504
NCBI-ProteinID: NP_061117
OMIM: 606122
HGNC: 11915
Ensembl: ENSG00000127863
Vega: OTTHUMG00000016568
Pharos: Q9NS68(Tbio)
UniProt: Q9NS68 A0A024RDM5
Position
13q12.12
AA seq 423 aa AA seqDB search
MALKVLLEQEKTFFTLLVLLGYLSCKVTCESGDCRQQEFRDRSGNCVPCNQCGPGMELSK
ECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLPG
FYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALAT
VLLALLILCVIYCKRQFMEKKPSWSLRSQDIQYNGSELSCFDRPQLHEYAHRACCQCRRD
SVQTCGPVRLLPSMCCEEACSPNPATLGCGVHSAASLQARNAGPAGEMVPTFFGSLTQSI
CGEFSDAWPLMQNPMGGDNISFCDSYPELTGEDIHSLNPELESSTSLDSNSSQDLVGGAV
PVQSHSENFTAATDLSRYNNTLVESASTQDALTMRSQLDQESGAVIHPATQTSLQVRQRL
GSL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaaagtgctactagaacaagagaaaacgtttttcactcttttagtattacta
ggctatttgtcatgtaaagtgacttgtgaatcaggagactgtagacagcaagaattcagg
gatcggtctggaaactgtgttccctgcaaccagtgtgggccaggcatggagttgtctaag
gaatgtggcttcggctatggggaggatgcacagtgtgtgacgtgccggctgcacaggttc
aaggaggactggggcttccagaaatgcaagccctgtctggactgcgcagtggtgaaccgc
tttcagaaggcaaattgttcagccaccagtgatgccatctgcggggactgcttgccagga
ttttataggaagacgaaacttgtcggctttcaagacatggagtgtgtgccttgtggagac
cctcctcctccttacgaaccgcactgtgccagcaaggtcaacctcgtgaagatcgcgtcc
acggcctccagcccacgggacacggcgctggctgccgttatctgcagcgctctggccacc
gtcctgctggccctgctcatcctctgtgtcatctattgtaagagacagtttatggagaag
aaacccagctggtctctgcggtcacaggacattcagtacaacggctctgagctgtcgtgt
tttgacagacctcagctccacgaatatgcccacagagcctgctgccagtgccgccgtgac
tcagtgcagacctgcgggccggtgcgcttgctcccatccatgtgctgtgaggaggcctgc
agccccaacccggcgactcttggttgtggggtgcattctgcagccagtcttcaggcaaga
aacgcaggcccagccggggagatggtgccgactttcttcggatccctcacgcagtccatc
tgtggcgagttttcagatgcctggcctctgatgcagaatcccatgggtggtgacaacatc
tctttttgtgactcttatcctgaactcactggagaagacattcattctctcaatccagaa
cttgaaagctcaacgtctttggattcaaatagcagtcaagatttggttggtggggctgtt
ccagtccagtctcattctgaaaactttacagcagctactgatttatctagatataacaac
acactggtagaatcagcatcaactcaggatgcactaactatgagaagccagctagatcag
gagagtggtgctgtcatccacccagccactcagacgtccctccaggtaaggcagcgactg
ggttccctgtga

DBGET integrated database retrieval system