KEGG   Homo sapiens (human): 55505
Entry
55505             CDS       T01001                                 
Symbol
NOP10, CHINE2, DKCB1, NOLA3, NOP10P, PFBMFT9
Name
(RefSeq) NOP10 ribonucleoprotein
  KO
K11130  H/ACA ribonucleoprotein complex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Network
nt06510  Telomere length regulation
  Element
N01476  Assembly and trafficking of telomerase
N01477  Telomere elongation
Disease
H00507  Dyskeratosis congenita
H02569  Pulmonary fibrosis and/or bone marrow failure, telomere-related
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    55505 (NOP10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    55505 (NOP10)
   03032 DNA replication proteins [BR:hsa03032]
    55505 (NOP10)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Sno RNPs
   Box H/ACA snoRNPs
    55505 (NOP10)
 Prokaryotic type
    55505 (NOP10)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    Dyskerin complex
     55505 (NOP10)
SSDB
Motif
Pfam: Nop10p
Other DBs
NCBI-GeneID: 55505
NCBI-ProteinID: NP_061118
OMIM: 606471
HGNC: 14378
Ensembl: ENSG00000182117
UniProt: Q9NPE3
Structure
Position
15:complement(34341719..34343136)
AA seq 64 aa
MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQP
RPVL
NT seq 195 nt   +upstreamnt  +downstreamnt
atgtttctccagtattacctcaacgagcagggagatcgagtctatacgctgaagaaattt
gacccgatgggacaacagacctgctcagcccatcctgctcggttctccccagatgacaaa
tactctcgacaccgaatcaccatcaagaaacgcttcaaggtgctcatgacccagcaaccg
cgccctgtcctctga

DBGET integrated database retrieval system